Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   200293
Name   oriT1_ICEKpnWCHKP13F2-2 in_silico
Organism   Klebsiella pneumoniae strain WCHKP13F2
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   CP028391 (_)
oriT length   33 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 33 nt

>oriT1_ICEKpnWCHKP13F2-2
GGCTTAGCCAGTTTTCCGTATCCTGACACCTCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   14332 GenBank   AVW76099
Name   Replic_Relax_B7D34_11630_ICEKpnWCHKP13F2-2 insolico UniProt ID   _
Length   248 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 248 a.a.        Molecular weight: 29203.78 Da        Isoelectric Point: 10.3502

>AVW76099.2 molybdopterin-guanine dinucleotide biosynthesis protein MobC [Klebsiella pneumoniae]
MLISSYHERQTRNSEKIRQLLNFLKEETYSDFKTLMQLFSFRDHKSLYSLLAKMERMGLIQKHMLESRTI
KISLWGITSDGLAAVLTPNDKIFPARFEPSKITGWTLEHHLDNQAARLILEKKGASGWINGDRASFLSQY
QVKHRPDGLLTLPDGNVIAIETERRLKTRARYQSIIASHLLARTNKYWIYIFYVVPDPQKKRALELLFDS
IRHVIINHQHIPLEERHRRVFRIYTFDELKHLSLGSYT

  Protein domains



No domain identified.



  Protein structure



No available structure.




T4CP


ID   16822 GenBank   AVW76100
Name   t4cp2_B7D34_11635_ICEKpnWCHKP13F2-2 insolico UniProt ID   _
Length   619 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 619 a.a.        Molecular weight: 69463.55 Da        Isoelectric Point: 6.2155

>AVW76100.1 TraM recognition domain-containing protein [Klebsiella pneumoniae]
MILNKLAASLSPIVNGMLALLAFVQQQQLVLALLAGLTMPFFASMKSDERQKAPLWKKLIIAFSLLCFLS
GTLAPVVIGPFQWLYKIRPSSDNTVLAWSVRIAFTVTGVIFHIMLRRIFTPELDKIKKRLVKKTTLEREL
RTDVRTVKSLLPETLHYDPLDYIDLNKGIFTGMDRENEPMYLPFKDWQKQHADIIGTTGAGKGVAAGILL
YQSIIAGEGVFVMDPKDDEWAPHLYRKACEDAGKPFALIDLRKQQYQLNLIEDITPDELEELFVAGFSLA
EKGQESDFYRIDDRKAARMAAQFVSDNPSATLRDIYNGDYVQGIAEKIKAFFGKIEELALLNAINSPEGF
SLKHIFDEGGCCYVVGSMRNSKIITAQRMLLVRLYQLAERRDRVTDVPRPIAVYLSELKYHLSRPALEGL
GAARDKGVHIIMDHQSIADLKDCPADLKGDAVVGAVVENAKFKLVYRVMDPDTAGWVARMSGTILVDDEL
RKAKTDNMLTETIDSERTIRQAERFFIDSNMILNLPDFVSFIFTTKTLPSASLISPIKVRKRQLKIFSVS
PDIAAAAAPVKIMLDFGEDDKPAMPDVMTTHPALFFDESEVKPAKSQSDDEEHFSPLDF

  Protein domains



No domain identified.


  Protein structure



No available structure.



ID   16823 GenBank   AVW76112
Name   t4cp2_B7D34_11700_ICEKpnWCHKP13F2-2 insolico UniProt ID   _
Length   912 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 912 a.a.        Molecular weight: 103049.96 Da        Isoelectric Point: 7.1738

>AVW76112.1 ATPase [Klebsiella pneumoniae]
MAKLLKAMKRPAALWGVPMVPLLAVTGVTIIVAVWTSVALLFLLPVEFLVMKSLTRNEPMRFNLIAVWLR
VKGKPVANRLFGATTLMPVEHEAVDIKEFLDAMKLNQCATIKKYIPYSSHIHQHVVRSPKSDLYCTWELM
GTSFDCESDESLQFGTNQLHGLIHSFEGMPVTFYIHNDRNTFTDNLHKDSGNPYADEVSRLYYASVGVFR
RNRLFLTVCYRPFVSLEKAERKRMKDSQKLKELDGALLEMLEIKSTLDTALSRYGARPLGTFTEGSAVFS
SQLAFYEYLLTHQWRKVRVTRTPAYDVMGAAALFFSAESGQINHANGTQYFRGLEVKEFSEETATGMMDS
LLYAPCDYVITQSYTCMSREEAKKAIKRTRRLLMSADDDAVSQRLDLDVALDLLTSGKIAYGKHHFSIMV
YSPSLENLVADTNEISNALNNIGITPVPAEISLSAAYMAQLPGNYNLRPRKGELSSQNFVELAALHNFYP
GKRDKAPWGDAMALLRTPSGDGYYINLHNTLADKDEFNEKNPASTCILGTNGSGKTMLMTFFEIMQQKYG
REDSFSPDAKTKRLTTVYLDKDRGAEMNIRALGGRYYRVISGESTGWNPFSLPATKRNINFIKQLMKILC
TRNGSTISPRDERRLSDAVNAVMNDEPQYRVYGITRMLENLPEPATKEAQENGLSIRLSQWAQGGEFGWV
FDNESDTFDISNCDNFGIDGTEFLDDASVCAPISFYLLYRITSLLDGRRLVIFMDEFWKWLRDPVFKDFA
YNKLKTIRKLNGMLVVGTQSPAEIIKDDIAPAVIEQCGTQILAANPNADRAHYVDDMKFEPEVFDVVKGL
DPQARQYVVVKNQFKRGDTKRFAARVTLDLSGIGRYTKVMSGDAPNLEIFESIYREGMQPHEWLDTYLAK
AL

  Protein domains


Predicted by InterproScan.

(3-79)

(269-470)

(535-813)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 1823127..1836977

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
B7D34_11280 1818308..1819822 + 1515 AVW76037 precolibactin peptidase ClbP -
B7D34_11285 1819815..1820537 + 723 AVW76038 colibactin biosynthesis thioesterase ClbQ -
B7D34_11290 1820572..1821084 + 513 AVW76039 colibactin self-protection protein ClbS -
B7D34_29220 1821069..1821272 + 204 QEO60418 hypothetical protein -
B7D34_11295 1822280..1822378 - 99 Protein_1724 nuclease -
B7D34_11300 1822354..1823118 - 765 AVW76040 molybdopterin-guanine dinucleotide biosynthesis protein MobC -
B7D34_11305 1823127..1824866 - 1740 AVW76041 type IV secretion system DNA-binding domain-containing protein virb4
B7D34_11310 1824957..1825211 - 255 AVW76042 hypothetical protein -
B7D34_11315 1825230..1825622 - 393 AVW76043 hypothetical protein -
B7D34_11320 1825644..1825949 - 306 AVW76044 dpoa decarboxylase -
B7D34_11325 1825992..1826294 - 303 AVW76045 kikA from plasmid origin -
B7D34_11330 1826328..1826726 - 399 AVW76046 Cag pathogenicity island protein Cag12 -
B7D34_11335 1826723..1827748 - 1026 AVW76047 P-type DNA transfer ATPase VirB11 virB11
B7D34_11340 1827738..1828058 - 321 AVW76048 hypothetical protein -
B7D34_11345 1828070..1829311 - 1242 AVW76049 TrbI/VirB10 family protein virB10
B7D34_11350 1829355..1830260 - 906 AVW76050 P-type conjugative transfer protein VirB9 virB9
B7D34_11355 1830260..1830943 - 684 AVW76051 type IV secretion system protein virB8
B7D34_11360 1831165..1832235 - 1071 AVW76052 type IV secretion system protein virB6
B7D34_11365 1832247..1832471 - 225 AVW76053 EexN family lipoprotein -
B7D34_11370 1832483..1833190 - 708 AVW76054 type IV secretion system protein VirB5 -
B7D34_11375 1833209..1835953 - 2745 AVW76055 ATPase virb4
B7D34_11380 1835965..1836270 - 306 AVW76056 TrbC/VirB2 family protein virB2
B7D34_11385 1836267..1836977 - 711 AVW76057 lytic transglycosylase domain-containing protein virB1
B7D34_11390 1837872..1838081 - 210 AVW76058 TraR/DksA family transcriptional regulator -
B7D34_11395 1838071..1838655 - 585 AVW76059 DUF2857 domain-containing protein -
B7D34_11400 1838844..1839029 - 186 AVW76060 AlpA family transcriptional regulator -
B7D34_11405 1839171..1840097 - 927 AVW76061 hypothetical protein -
B7D34_11410 1840567..1841196 + 630 AVW76062 LuxR family transcriptional regulator -

Region 2: 1884820..1894050

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
B7D34_11630 1880408..1881154 - 747 AVW76099 molybdopterin-guanine dinucleotide biosynthesis protein MobC -
B7D34_11635 1881164..1883023 - 1860 AVW76100 TraM recognition domain-containing protein -
B7D34_11640 1883041..1883301 - 261 AVW76101 hypothetical protein -
B7D34_11645 1883320..1883712 - 393 AVW76102 hypothetical protein -
B7D34_11650 1883733..1884038 - 306 AVW76103 dpoa decarboxylase -
B7D34_11655 1884083..1884385 - 303 AVW76104 kikA from plasmid origin -
B7D34_11660 1884421..1884823 - 403 Protein_1792 Cag pathogenicity island protein Cag12 -
B7D34_11665 1884820..1885845 - 1026 AVW76105 P-type DNA transfer ATPase VirB11 virB11
B7D34_11670 1885835..1887097 - 1263 AVW76106 type VI secretion protein virB10
B7D34_11675 1887141..1888046 - 906 AVW76107 P-type conjugative transfer protein VirB9 virB9
B7D34_11680 1888046..1888729 - 684 AVW76108 type IV secretion system protein virB8
B7D34_11685 1888947..1890020 - 1074 AVW76109 type IV secretion system protein virB6
B7D34_11690 1890024..1890266 - 243 AVW76110 EexN family lipoprotein -
B7D34_11695 1890274..1890987 - 714 AVW76111 type IV secretion system protein VirB5 -
B7D34_11700 1891006..1893744 - 2739 AVW76112 ATPase virb4
B7D34_11705 1893757..1894050 - 294 AVW76113 TrbC/VirB2 family protein virB2
B7D34_11710 1894050..1894761 - 712 Protein_1802 lytic transglycosylase domain-containing protein -
B7D34_11715 1894834..1895067 - 234 AVW76114 hypothetical protein -
B7D34_11720 1895636..1895788 - 153 AVW76115 transcriptional regulator -
B7D34_11725 1896007..1896216 - 210 AVW76116 TraR/DksA family transcriptional regulator -
B7D34_11730 1896206..1896787 - 582 AVW76117 DUF2857 domain-containing protein -
B7D34_11735 1896772..1896957 - 186 AVW76118 hypothetical protein -
B7D34_11740 1896976..1897161 - 186 AVW76119 AlpA family transcriptional regulator -
B7D34_29225 1897301..1897855 - 555 QEO60441 hypothetical protein -
B7D34_29230 1897871..1898284 - 414 Protein_1810 hypothetical protein -


Host bacterium


ID   266 Element type   ICE (Integrative and conjugative element)
Element name   ICEKpnWCHKP13F2-1 GenBank   CP028391
Element size   5375242 bp Coordinate of oriT [Strand]   56789..56912 [-]
Host bacterium   Klebsiella pneumoniae strain WCHKP13F2 Coordinate of element   1768391..1849138

Cargo genes


Drug resistance gene   -
Virulence gene   clbA, clbB, clbC, clbD, clbE, clbF, clbG, clbH, clbI, clbJ, clbK, clbL, clbM, clbN, clbO, clbP, clbQ, clbS, fyuA, ybtE, ybtT, ybtU, irp1, irp2, ybtA, ybtP, ybtQ, ybtX, ybtS
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -