Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 200093 |
| Name | oriT_TnGBS1  |
| Organism | Streptococcus agalactiae NEM316 |
| Sequence Completeness | intact |
| NCBI accession of oriT (coordinates [strand]) | NC_004368 (395366..395420 [+], 55 nt) |
| oriT length | 55 nt |
| IRs (inverted repeats) | IR1: 1..7, 9..15 (GTTGATA..TATCAAC) IR2: 16..23, 26..34 (TCCACACG..ACGTGGGGA) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note |
oriT sequence
Download Length: 55 nt
>oriT_TnGBS1
GTTGATACTATCAACTCCACACGGCACGTGGGGACAGTTTCCCTTATGCTCTTTT
GTTGATACTATCAACTCCACACGGCACGTGGGGACAGTTTCCCTTATGCTCTTTT
Visualization of oriT structure (The oriT was characterized experimentally)
oriT secondary structure
Predicted by RNAfold.
Download structure file
Reference
[1] Romain Guérillot et al. (2013) Modular evolution of TnGBSs, a new family of integrative and conjugative elements associating insertion sequence transposition, plasmid replication, and conjugation for their spreading. Journal of bacteriology. 195(9):1979-90. [PMID:23435978]
Relaxase
| ID | 1097 | GenBank | WP_000383377 |
| Name | gbs0380_TnGBS1  |
UniProt ID | Q8CME2 |
| Length | 788 a.a. | PDB ID | |
| Note | |||
Relaxase protein sequence
Download Length: 788 a.a. Molecular weight: 91496.55 Da Isoelectric Point: 8.7839
>WP_000383377.1 MULTISPECIES: MobP2 family relaxase [Streptococcus]
MDVSSSPNITFMLQYTEANPQYVDYTNREEAVKIDEELSLETNRQMIEGLTEDELTRIQEAVPETQLNFR
EYIDYMNRSYATEEQSKELTAIFTQEADYLQKLRLIDLKNKLESAYQNGSLLWQGVISFDNAFLAEQGLY
DVATGQVDQKAIKAVMRDMMPTLIQKEGLSDSAFWWGNIHLNTDNIHIHFGLSEVESNREKIFYQPRGRM
EYKGNFSQKTINRFKSGVYHGLLKEETRSNLLRKEQILANLKADFITSIYQKDKITSSAEKNFLEQAYNH
LPLNKKWRYGSNARDFAVSKFFLDRYLDSYLNNEGSAAYQEFLKETRDFLQTYEGVYSAEKNKIYEKLRK
VDGQTIRTLAESKGYDLEHHLARRVMDLRERLANNILRSFREAAPQIQDVQLEKNLESFSVLNQKKILEQ
HPEASVVKSQKAWQKLGYFVKAGEQPLEIIRPVYKSYDKHGKGIGRPEFVSDTVYDISQLTENIQLKSLT
LKDLSLFSSNELKELVDAAKLKTNPTERERRELGTYRYALKLSILESSQKELQVRQKLLEQVQPLASDQP
FLDFKKQLIAQELQAIALQLTPNYKLSEDDKALKNRLKRQFEDSVALPVSKATPGAIQLPIRQLWTELGL
VHHIQDENILTLLKGTSTTKQAYIEELQTHISIFQLKYQINNRNKQISQLSDEATIKEMRIANAKGFSEL
KRLYDTLQPSDDGQNQISQAVSKQLQERKVIKKAQLQQTQRSGKINTDFMRQLTASLNRSQQASKKALME
RARSDEREEQEERRQAQR
MDVSSSPNITFMLQYTEANPQYVDYTNREEAVKIDEELSLETNRQMIEGLTEDELTRIQEAVPETQLNFR
EYIDYMNRSYATEEQSKELTAIFTQEADYLQKLRLIDLKNKLESAYQNGSLLWQGVISFDNAFLAEQGLY
DVATGQVDQKAIKAVMRDMMPTLIQKEGLSDSAFWWGNIHLNTDNIHIHFGLSEVESNREKIFYQPRGRM
EYKGNFSQKTINRFKSGVYHGLLKEETRSNLLRKEQILANLKADFITSIYQKDKITSSAEKNFLEQAYNH
LPLNKKWRYGSNARDFAVSKFFLDRYLDSYLNNEGSAAYQEFLKETRDFLQTYEGVYSAEKNKIYEKLRK
VDGQTIRTLAESKGYDLEHHLARRVMDLRERLANNILRSFREAAPQIQDVQLEKNLESFSVLNQKKILEQ
HPEASVVKSQKAWQKLGYFVKAGEQPLEIIRPVYKSYDKHGKGIGRPEFVSDTVYDISQLTENIQLKSLT
LKDLSLFSSNELKELVDAAKLKTNPTERERRELGTYRYALKLSILESSQKELQVRQKLLEQVQPLASDQP
FLDFKKQLIAQELQAIALQLTPNYKLSEDDKALKNRLKRQFEDSVALPVSKATPGAIQLPIRQLWTELGL
VHHIQDENILTLLKGTSTTKQAYIEELQTHISIFQLKYQINNRNKQISQLSDEATIKEMRIANAKGFSEL
KRLYDTLQPSDDGQNQISQAVSKQLQERKVIKKAQLQQTQRSGKINTDFMRQLTASLNRSQQASKKALME
RARSDEREEQEERRQAQR
Protein domains
Predicted by InterproScan.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q8CME2 |
Reference
[1] Romain Guérillot et al. (2013) Modular evolution of TnGBSs, a new family of integrative and conjugative elements associating insertion sequence transposition, plasmid replication, and conjugation for their spreading. Journal of bacteriology. 195(9):1979-90. [PMID:23435978]
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 408918..1191186
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GBS_RS02320 (gbs0387) | 405244..406992 | + | 1749 | WP_000259054 | DNA topoisomerase | - |
| GBS_RS02325 (gbs0388) | 406994..408826 | + | 1833 | WP_011074711 | ATP-dependent Clp protease ATP-binding subunit | - |
| GBS_RS02330 (gbs0389) | 408918..409265 | + | 348 | WP_000797377 | TrbC/VirB2 family protein | virB2 |
| GBS_RS02335 (gbs0390) | 409276..410358 | + | 1083 | WP_000874146 | hypothetical protein | - |
| GBS_RS02340 (gbs0391) | 410373..412634 | + | 2262 | WP_000809481 | C39 family peptidase | - |
| GBS_RS02345 (gbs0392) | 412711..413433 | + | 723 | WP_000163068 | LPXTG cell wall anchor domain-containing protein | prgC |
| GBS_RS02350 (gbs0393) | 413485..416286 | + | 2802 | WP_001087701 | SspB-related isopeptide-forming adhesin | prgB |
| GBS_RS02355 (gbs0394) | 416458..416889 | + | 432 | WP_001154843 | single-stranded DNA-binding protein | - |
| GBS_RS02360 (gbs0395) | 417117..417374 | + | 258 | WP_000047046 | hypothetical protein | - |
| GBS_RS02365 (gbs0396) | 417367..420516 | + | 3150 | WP_000493311 | VirD4-like conjugal transfer protein, CD1115 family | - |
| GBS_RS02370 (gbs0397) | 420616..421098 | + | 483 | WP_000782571 | hypothetical protein | - |
| GBS_RS02375 (gbs0398) | 421218..423425 | + | 2208 | WP_000220530 | pLS20_p028 family conjugation system transmembrane protein | virB6 |
| GBS_RS02380 (gbs0399) | 423434..423715 | + | 282 | WP_000362284 | BRCT domain-containing protein | - |
| GBS_RS02385 (gbs0400) | 423946..424251 | + | 306 | WP_000343797 | DUF5592 family protein | - |
| GBS_RS02390 (gbs0401) | 424251..424898 | + | 648 | WP_000985710 | hypothetical protein | - |
| GBS_RS02395 (gbs0402) | 424908..426857 | + | 1950 | WP_001114671 | virulence factor | - |
| GBS_RS02400 (gbs0403) | 426877..427134 | + | 258 | WP_000078851 | hypothetical protein | - |
| GBS_RS02405 (gbs0404) | 427148..428485 | + | 1338 | WP_000758177 | CHAP domain-containing protein | prgK |
| GBS_RS02410 (gbs0405) | 428499..429083 | + | 585 | WP_000666008 | hypothetical protein | - |
| GBS_RS02415 (gbs0406) | 429222..430040 | + | 819 | WP_001222610 | AAA family ATPase | - |
| GBS_RS02420 (gbs0407) | 430037..430315 | + | 279 | WP_000131727 | hypothetical protein | - |
| GBS_RS02425 (gbs0408) | 430328..430711 | + | 384 | WP_000323828 | replication initiator protein A | - |
| GBS_RS02430 (gbs0409) | 430716..431027 | + | 312 | WP_000583310 | hypothetical protein | - |
| GBS_RS02435 (gbs0410) | 431161..432489 | + | 1329 | WP_000151682 | ISLre2 family transposase | - |
| GBS_RS02440 (gbs0411) | 432906..433706 | + | 801 | WP_000155919 | phosphotransferase family protein | - |
| GBS_RS02445 (gbs0412) | 433696..434331 | + | 636 | WP_001266024 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
| GBS_RS02455 | 434821..435297 | + | 477 | WP_041971671 | ribosome maturation factor RimP | - |
| GBS_RS02460 (gbs0414) | 435333..436484 | + | 1152 | WP_000032295 | transcription termination factor NusA | - |
| GBS_RS02465 (gbs0415) | 436506..436802 | + | 297 | WP_001140526 | YlxR family protein | - |
| GBS_RS02470 (gbs0416) | 436795..437097 | + | 303 | WP_001065560 | YlxQ-related RNA-binding protein | - |
| GBS_RS02475 (gbs0417) | 437117..439900 | + | 2784 | WP_000039152 | translation initiation factor IF-2 | - |
| GBS_RS02480 | 440009..440359 | + | 351 | WP_001273670 | 30S ribosome-binding factor RbfA | - |
| GBS_RS02485 (gbs0419) | 440443..441447 | - | 1005 | WP_000804611 | alpha/beta hydrolase | - |
| GBS_RS02490 (gbs0420) | 441611..442027 | + | 417 | WP_000156042 | CopY/TcrY family copper transport repressor | - |
| GBS_RS02495 (gbs0421) | 442040..444274 | + | 2235 | WP_000013400 | heavy metal translocating P-type ATPase | - |
| GBS_RS02500 (gbs0422) | 444315..444521 | + | 207 | WP_000683375 | heavy-metal-associated domain-containing protein | - |
| GBS_RS02505 (gbs0423) | 444631..445245 | + | 615 | WP_000020721 | trimeric intracellular cation channel family protein | - |
| GBS_RS02510 (gbs0424) | 445260..446072 | + | 813 | WP_000593336 | Cof-type HAD-IIB family hydrolase | - |
| GBS_RS02515 (gbs0425) | 446185..448827 | + | 2643 | WP_000182605 | DNA polymerase I | - |
| GBS_RS02520 (gbs0426) | 448857..449297 | + | 441 | WP_000262487 | CoA-binding protein | - |
| GBS_RS02525 (gbs0427) | 449379..449858 | + | 480 | WP_000377090 | peroxide-responsive transcriptional repressor PerR | - |
| GBS_RS02530 (gbs0428) | 450011..451576 | + | 1566 | WP_000703866 | plasminogen-binding protein PbsP | - |
| GBS_RS02535 (gbs0429) | 451689..452375 | + | 687 | WP_000192298 | response regulator transcription factor | - |
| GBS_RS02540 (gbs0430) | 452377..453414 | + | 1038 | WP_000770240 | HAMP domain-containing sensor histidine kinase | - |
| GBS_RS02545 (gbs0431) | 453428..454168 | - | 741 | WP_000185054 | DUF975 family protein | - |
| GBS_RS02550 (gbs0432) | 454355..455497 | + | 1143 | WP_000129510 | tRNA guanosine(34) transglycosylase Tgt | - |
| GBS_RS02555 (gbs0433) | 455604..455915 | + | 312 | WP_000983191 | CHY zinc finger protein | - |
| GBS_RS02560 (gbs0434) | 455922..456461 | + | 540 | WP_000469149 | biotin transporter BioY | - |
| GBS_RS02565 (gbs0435) | 456600..457376 | + | 777 | WP_000779461 | MBL fold metallo-hydrolase | - |
| GBS_RS02570 (gbs0436) | 457376..457882 | + | 507 | WP_001169006 | tRNA adenosine(34) deaminase TadA | - |
| GBS_RS02580 (gbs0437) | 458154..459503 | + | 1350 | WP_000148892 | glucose-6-phosphate isomerase | - |
| GBS_RS02585 (gbs0438) | 459825..460352 | + | 528 | WP_000412413 | 5-formyltetrahydrofolate cyclo-ligase | - |
| GBS_RS02590 (gbs0439) | 460343..461020 | + | 678 | WP_000061940 | rhomboid family intramembrane serine protease | - |
| GBS_RS02595 (gbs0440) | 461152..462195 | + | 1044 | WP_001080265 | BMP family protein | - |
| GBS_RS02600 (gbs0441) | 462286..463185 | - | 900 | WP_000868271 | UTP--glucose-1-phosphate uridylyltransferase GalU | - |
| GBS_RS02605 (gbs0442) | 463222..464238 | - | 1017 | WP_000166111 | NAD(P)H-dependent glycerol-3-phosphate dehydrogenase | - |
| GBS_RS02610 (gbs0443) | 464408..464737 | + | 330 | WP_000754612 | ribonuclease P protein component | - |
| GBS_RS02615 (gbs0444) | 464750..465565 | + | 816 | WP_000727922 | membrane protein insertase YidC | - |
| GBS_RS02620 (gbs0445) | 465573..466394 | + | 822 | WP_000242578 | RNA-binding cell elongation regulator Jag/EloR | - |
| GBS_RS02680 (gbs0446) | 472355..472888 | - | 534 | WP_001239184 | DUF402 domain-containing protein | - |
| GBS_RS02685 (gbs0447) | 472972..473748 | - | 777 | WP_000704977 | recombination regulator RecX | - |
| GBS_RS02690 (gbs0448) | 473847..475202 | + | 1356 | WP_001103623 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| GBS_RS02695 (gbs0449) | 475469..476233 | + | 765 | WP_000586351 | nucleoside phosphorylase | - |
| GBS_RS02700 (gbs0450) | 476267..476695 | + | 429 | WP_000267396 | GNAT family N-acetyltransferase | - |
| GBS_RS02705 (gbs0451) | 476883..480584 | + | 3702 | WP_000357569 | S8 family serine peptidase | - |
| GBS_RS02710 (gbs0452) | 480794..481702 | + | 909 | WP_000848924 | glycosyltransferase family 2 protein | - |
| GBS_RS02715 (gbs0453) | 482255..483265 | + | 1011 | WP_001192438 | class 1b ribonucleoside-diphosphate reductase subunit beta | - |
| GBS_RS02720 (gbs0454) | 483266..483679 | + | 414 | WP_000378632 | class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI | - |
| GBS_RS02725 (gbs0455) | 483681..485849 | + | 2169 | WP_000194372 | class 1b ribonucleoside-diphosphate reductase subunit alpha | - |
| GBS_RS02730 (gbs0456) | 485912..489079 | + | 3168 | WP_000162181 | leucine-rich repeat domain-containing protein | - |
| GBS_RS02735 (gbs0457) | 489092..489481 | + | 390 | WP_000632621 | pyridoxamine 5'-phosphate oxidase family protein | - |
| GBS_RS02740 (gbs0458) | 489525..490016 | - | 492 | WP_000948274 | GyrI-like domain-containing protein | - |
| GBS_RS02745 (gbs0459) | 490255..490539 | - | 285 | WP_000955821 | DUF2316 family protein | - |
| GBS_RS02750 (gbs0460) | 490626..490943 | - | 318 | WP_000660666 | carboxymuconolactone decarboxylase family protein | - |
| GBS_RS02755 (gbs0461) | 490967..491362 | - | 396 | WP_001158468 | cupin domain-containing protein | - |
| GBS_RS02760 (gbs0462) | 491372..491761 | - | 390 | WP_000547676 | stress response transcriptional regulator NmlR | - |
| GBS_RS02765 | 491777..492813 | - | 1037 | Protein_463 | zinc-dependent alcohol dehydrogenase family protein | - |
| GBS_RS02770 | 492923..493777 | - | 855 | Protein_464 | aldo/keto reductase | - |
| GBS_RS02775 (gbs0467) | 493862..494725 | - | 864 | WP_000203282 | cation diffusion facilitator family transporter | - |
| GBS_RS02780 (gbs0468) | 494857..495381 | + | 525 | WP_000237802 | TetR/AcrR family transcriptional regulator | - |
| GBS_RS02785 (gbs0469) | 495576..496769 | - | 1194 | WP_000564880 | YSIRK-targeted surface antigen transcriptional regulator | - |
| GBS_RS11195 | 497012..500392 | + | 3381 | WP_000489962 | alpha-like surface protein | - |
| GBS_RS11200 | 500852..501001 | - | 150 | Protein_469 | IS256 family transposase | - |
| GBS_RS02795 (gbs0471) | 501058..501351 | + | 294 | WP_000108710 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| GBS_RS02800 (gbs0472) | 501348..501686 | + | 339 | WP_000565282 | hypothetical protein | - |
| GBS_RS02805 (gbs0473) | 501689..502045 | + | 357 | WP_000728322 | hypothetical protein | - |
| GBS_RS02810 (gbs0474) | 502110..502532 | - | 423 | WP_000366194 | ImmA/IrrE family metallo-endopeptidase | - |
| GBS_RS02815 (gbs0475) | 502539..502877 | - | 339 | WP_000936458 | helix-turn-helix transcriptional regulator | - |
| GBS_RS02820 | 503115..503666 | + | 552 | WP_001011700 | hypothetical protein | - |
| GBS_RS11915 | 503834..503977 | - | 144 | WP_000528441 | putative holin-like toxin | - |
| GBS_RS02830 (gbs0477) | 504118..504372 | + | 255 | Protein_477 | hypothetical protein | - |
| GBS_RS02835 (gbs0478) | 504498..505055 | + | 558 | WP_000702264 | hypothetical protein | - |
| GBS_RS02840 (gbs0479) | 505080..505841 | + | 762 | WP_000159544 | LPXTG cell wall anchor domain-containing protein | - |
| GBS_RS02845 (gbs0480) | 506077..506619 | + | 543 | WP_000935940 | hypothetical protein | - |
| GBS_RS02850 (gbs0481) | 506792..507118 | + | 327 | WP_001188029 | DUF771 domain-containing protein | - |
| GBS_RS11920 | 507168..508303 | + | 1136 | Protein_482 | site-specific integrase | - |
| GBS_RS02870 | 508521..508826 | - | 306 | WP_000484318 | hypothetical protein | - |
| GBS_RS02875 (gbs0485) | 508828..509166 | - | 339 | WP_000120348 | cupin domain-containing protein | - |
| GBS_RS02880 (gbs0486) | 509187..509942 | - | 756 | WP_000018433 | class I SAM-dependent methyltransferase | - |
| GBS_RS02885 (gbs0487) | 510253..510507 | + | 255 | WP_000119699 | DUF1912 family protein | - |
| GBS_RS02890 (gbs0488) | 510616..510927 | + | 312 | WP_001119100 | hypothetical protein | - |
| GBS_RS02895 (gbs0489) | 511196..511765 | + | 570 | WP_001166208 | GNAT family protein | - |
| GBS_RS02900 (gbs0490) | 511863..512447 | + | 585 | WP_000590590 | GNAT family protein | - |
| GBS_RS02905 (gbs0491) | 512444..513010 | + | 567 | WP_001021312 | AAA family ATPase | - |
| GBS_RS02910 (gbs0492) | 513010..515664 | + | 2655 | WP_000032211 | valine--tRNA ligase | - |
| GBS_RS02915 (gbs0493) | 515900..516829 | - | 930 | WP_000064105 | hypothetical protein | - |
| GBS_RS02920 (gbs0494) | 517246..518205 | + | 960 | WP_000049317 | Gfo/Idh/MocA family oxidoreductase | - |
| GBS_RS02925 (gbs0495) | 518366..519268 | + | 903 | WP_000492950 | magnesium transporter CorA family protein | - |
| GBS_RS02930 (gbs0496) | 519428..520492 | + | 1065 | WP_000021293 | MmcQ/YjbR family DNA-binding protein | - |
| GBS_RS02935 (gbs0497) | 520607..521599 | + | 993 | WP_000748015 | aspartate--ammonia ligase | - |
| GBS_RS02940 (gbs0498) | 521644..522093 | - | 450 | WP_000592261 | hypothetical protein | - |
| GBS_RS02945 | 522224..522763 | + | 540 | WP_001266830 | 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD | - |
| GBS_RS02950 (gbs0500) | 522775..523065 | + | 291 | WP_000384889 | hypothetical protein | - |
| GBS_RS02955 (gbs0501) | 523062..523547 | + | 486 | WP_000161894 | pantetheine-phosphate adenylyltransferase | - |
| GBS_RS02960 (gbs0502) | 523537..524610 | + | 1074 | WP_000790651 | SepM family pheromone-processing serine protease | - |
| GBS_RS02965 (gbs0503) | 524685..526019 | + | 1335 | WP_000137518 | metallophosphoesterase | - |
| GBS_RS02970 (gbs0504) | 526088..526666 | + | 579 | WP_001224500 | YutD-like domain-containing protein | - |
| GBS_RS02975 (gbs0505) | 526717..527823 | + | 1107 | WP_000039435 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| GBS_RS02980 (gbs0506) | 527823..528338 | + | 516 | WP_000919807 | VanZ family protein | - |
| GBS_RS02985 (gbs0507) | 528534..530279 | + | 1746 | WP_000022469 | ABC transporter transmembrane domain-containing protein | - |
| GBS_RS02990 (gbs0508) | 530269..532008 | + | 1740 | WP_000841526 | ABC transporter ATP-binding protein | - |
| GBS_RS02995 (gbs0509) | 532136..532702 | + | 567 | WP_000925630 | aminodeoxychorismate/anthranilate synthase component II | - |
| GBS_RS03000 (gbs0510) | 532770..533309 | - | 540 | WP_000857892 | biotin transporter BioY | - |
| GBS_RS03005 (gbs0511) | 533310..534302 | - | 993 | WP_000009965 | biotin synthase BioB | - |
| GBS_RS03010 (gbs0512) | 534427..534942 | + | 516 | WP_000732603 | hypothetical protein | - |
| GBS_RS03015 | 534932..536046 | + | 1115 | Protein_512 | thiolase family protein | - |
| GBS_RS03020 (gbs0514) | 536039..537268 | + | 1230 | WP_000894043 | AMP-binding protein | - |
| GBS_RS03025 (gbs0515) | 537381..538013 | + | 633 | WP_000949175 | endonuclease III | - |
| GBS_RS03030 (gbs0516) | 538014..538409 | - | 396 | WP_000606044 | prepilin peptidase | - |
| GBS_RS03035 (gbs0517) | 538564..538773 | + | 210 | WP_000865866 | YqgQ family protein | - |
| GBS_RS03040 (gbs0518) | 538770..539738 | + | 969 | WP_000038547 | ROK family glucokinase | - |
| GBS_RS03045 (gbs0519) | 539750..540130 | + | 381 | WP_000367664 | rhodanese-like domain-containing protein | - |
| GBS_RS03050 (gbs0520) | 540362..542203 | + | 1842 | WP_000183429 | translational GTPase TypA | - |
| GBS_RS03055 | 542248..542493 | + | 246 | WP_000499533 | DUF3165 family protein | - |
| GBS_RS03060 (gbs0522) | 542623..543978 | + | 1356 | WP_000849675 | UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase | - |
| GBS_RS03065 (gbs0523) | 543981..545057 | + | 1077 | WP_000516700 | UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase | - |
| GBS_RS03070 (gbs0524) | 545061..546197 | + | 1137 | WP_001124855 | FtsQ-type POTRA domain-containing protein | - |
| GBS_RS03075 (gbs0525) | 546470..547843 | + | 1374 | WP_000113464 | cell division protein FtsA | - |
| GBS_RS03080 (gbs0526) | 547865..549145 | + | 1281 | WP_000232007 | cell division protein FtsZ | - |
| GBS_RS03085 (gbs0527) | 549151..549825 | + | 675 | WP_000981488 | YggS family pyridoxal phosphate-dependent enzyme | - |
| GBS_RS03090 (gbs0528) | 549837..550442 | + | 606 | WP_001185364 | cell division protein SepF | - |
| GBS_RS03095 (gbs0529) | 550445..550699 | + | 255 | WP_000604717 | YggT family protein | - |
| GBS_RS03100 (gbs0530) | 550701..551489 | + | 789 | WP_000171115 | YlmH/Sll1252 family protein | - |
| GBS_RS03105 (gbs0531) | 551499..552269 | + | 771 | WP_001131467 | DivIVA domain-containing protein | - |
| GBS_RS03110 (gbs0532) | 552554..555346 | + | 2793 | WP_000768154 | isoleucine--tRNA ligase | - |
| GBS_RS03115 (gbs0533) | 555463..555765 | - | 303 | WP_001237035 | DUF1827 family protein | - |
| GBS_RS03120 (gbs0534) | 555829..556284 | - | 456 | WP_000184290 | NUDIX hydrolase | - |
| GBS_RS03125 (gbs0535) | 556470..558731 | - | 2262 | WP_000882546 | ATP-dependent Clp protease ATP-binding subunit | - |
| GBS_RS03130 (gbs0536) | 559029..559259 | + | 231 | WP_000443582 | DUF1797 family protein | - |
| GBS_RS03135 (gbs0537) | 559400..560092 | + | 693 | WP_001011647 | amino acid ABC transporter permease | - |
| GBS_RS03140 (gbs0538) | 560085..560819 | + | 735 | WP_000230128 | amino acid ABC transporter ATP-binding protein | - |
| GBS_RS03145 (gbs0539) | 561106..562800 | + | 1695 | WP_001106854 | phospho-sugar mutase | - |
| GBS_RS03150 (gbs0540) | 562939..563793 | + | 855 | WP_000137498 | bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase | - |
| GBS_RS03155 (gbs0541) | 563790..564626 | + | 837 | WP_000634978 | NAD(P)H-hydrate dehydratase | - |
| GBS_RS03160 (gbs0542) | 564752..566092 | + | 1341 | WP_001286947 | exodeoxyribonuclease VII large subunit | - |
| GBS_RS03165 (gbs0543) | 566070..566285 | + | 216 | WP_001280900 | exodeoxyribonuclease VII small subunit | - |
| GBS_RS03170 (gbs0544) | 566285..567157 | + | 873 | WP_000256279 | polyprenyl synthetase family protein | - |
| GBS_RS03175 (gbs0545) | 567150..567977 | + | 828 | WP_001041040 | TlyA family rRNA (cytidine-2'-O)-methyltransferase | - |
| GBS_RS03180 (gbs0546) | 567964..568437 | + | 474 | WP_000747940 | ArgR family transcriptional regulator | - |
| GBS_RS03185 (gbs0547) | 568449..570107 | + | 1659 | WP_000923619 | DNA repair protein RecN | - |
| GBS_RS03190 (gbs0548) | 570220..571056 | + | 837 | WP_000034835 | DegV family protein | - |
| GBS_RS03195 (gbs0549) | 571049..571888 | + | 840 | WP_001035227 | SGNH/GDSL hydrolase family protein | - |
| GBS_RS03200 (gbs0550) | 571863..572465 | + | 603 | WP_000806954 | YpmS family protein | - |
| GBS_RS03205 | 572568..572843 | + | 276 | WP_001284634 | HU family DNA-binding protein | - |
| GBS_RS03210 | 573040..573237 | + | 198 | WP_001290370 | hypothetical protein | - |
| GBS_RS03215 (gbs0553) | 573281..574213 | - | 933 | WP_000254063 | dihydroorotate oxidase | - |
| GBS_RS03220 (gbs0554) | 574400..575635 | - | 1236 | WP_001185390 | aminoacyltransferase | - |
| GBS_RS03225 (gbs0555) | 575654..576865 | - | 1212 | WP_000285514 | aminoacyltransferase | - |
| GBS_RS03230 (gbs0556) | 576878..578098 | - | 1221 | WP_001865557 | aminoacyltransferase | - |
| GBS_RS03235 (gbs0557) | 578098..578910 | - | 813 | WP_000200668 | sugar-phosphatase | - |
| GBS_RS03240 (gbs0558) | 578981..580297 | - | 1317 | WP_001003543 | HD domain-containing protein | - |
| GBS_RS03245 (gbs0559) | 580373..580759 | + | 387 | WP_000764120 | DUF1934 domain-containing protein | - |
| GBS_RS03250 (gbs0560) | 581103..583787 | + | 2685 | WP_000910750 | calcium-translocating P-type ATPase, PMCA-type | - |
| GBS_RS03255 (gbs0561) | 583832..584692 | - | 861 | WP_000163483 | metallophosphoesterase | - |
| GBS_RS03260 (gbs0562) | 584844..586775 | + | 1932 | WP_000064640 | fructose-1,6-bisphosphatase | - |
| GBS_RS03265 (gbs0563) | 586865..587989 | + | 1125 | WP_000351637 | tRNA epoxyqueuosine(34) reductase QueG | - |
| GBS_RS03270 (gbs0564) | 588058..589156 | + | 1099 | WP_011324939 | peptide chain release factor 2 | - |
| GBS_RS03275 (gbs0565) | 589175..589867 | + | 693 | WP_001173889 | cell division ATP-binding protein FtsE | - |
| GBS_RS03280 (gbs0566) | 589851..590780 | + | 930 | WP_000236201 | permease-like cell division protein FtsX | - |
| GBS_RS03285 (gbs0567) | 590833..591543 | - | 711 | WP_001022575 | alpha/beta hydrolase | - |
| GBS_RS03290 (gbs0568) | 591540..592175 | - | 636 | WP_000708402 | MBL fold metallo-hydrolase | - |
| GBS_RS03295 (gbs0569) | 592406..593170 | + | 765 | WP_000048144 | (S)-acetoin forming diacetyl reductase | - |
| GBS_RS03300 (gbs0570) | 593320..595785 | + | 2466 | WP_000192261 | bifunctional DnaQ family exonuclease/ATP-dependent helicase | - |
| GBS_RS03305 (gbs0571) | 595871..597064 | + | 1194 | WP_000221826 | pyridoxal phosphate-dependent aminotransferase | - |
| GBS_RS03310 (gbs0572) | 597085..598431 | + | 1347 | WP_000038470 | asparagine--tRNA ligase | - |
| GBS_RS03315 (gbs0573) | 598471..599028 | - | 558 | WP_000167491 | ECF transporter S component | - |
| GBS_RS03320 (gbs0574) | 599025..600008 | - | 984 | WP_001031097 | nucleoside hydrolase | - |
| GBS_RS03325 | 600254..600667 | - | 414 | WP_000965180 | OsmC family protein | - |
| GBS_RS03330 (gbs0576) | 600821..601711 | + | 891 | WP_001278848 | RNase adapter RapZ | - |
| GBS_RS03335 (gbs0577) | 601708..602682 | + | 975 | WP_001231102 | YvcK family protein | - |
| GBS_RS03340 (gbs0578) | 602679..603590 | + | 912 | WP_000011316 | DNA-binding protein WhiA | - |
| GBS_RS03345 (gbs0579) | 603605..605002 | + | 1398 | WP_000752457 | C69 family dipeptidase | - |
| GBS_RS03350 (gbs0580) | 605144..606664 | + | 1521 | WP_001227406 | zinc ABC transporter substrate-binding protein AdcA | - |
| GBS_RS03355 | 606777..607037 | - | 261 | WP_000710757 | type B 50S ribosomal protein L31 | - |
| GBS_RS03360 (gbs0582) | 607146..608081 | - | 936 | WP_000583238 | bifunctional oligoribonuclease/PAP phosphatase NrnA | - |
| GBS_RS03365 (gbs0583) | 608347..609369 | + | 1023 | WP_000189639 | adenosine deaminase | - |
| GBS_RS03370 (gbs0584) | 609428..609871 | + | 444 | WP_001162136 | flavodoxin | - |
| GBS_RS03375 (gbs0585) | 609948..610223 | + | 276 | WP_000418127 | chorismate mutase | - |
| GBS_RS03380 (gbs0586) | 610216..611412 | + | 1197 | WP_000595708 | voltage-gated chloride channel family protein | - |
| GBS_RS03385 (gbs0587) | 611992..612339 | + | 348 | WP_001068667 | 50S ribosomal protein L19 | - |
| GBS_RS11210 | 612484..613065 | - | 582 | WP_001865706 | site-specific integrase | - |
| GBS_RS03395 | 613101..613367 | - | 267 | WP_001872365 | hypothetical protein | - |
| GBS_RS11815 | 613388..614750 | + | 1363 | Protein_589 | IS3 family transposase | - |
| GBS_RS11220 | 614923..615084 | - | 162 | WP_000508795 | NINE protein | - |
| GBS_RS03415 (gbs0594) | 615826..617103 | + | 1278 | WP_000594360 | ABC transporter permease | - |
| GBS_RS03420 (gbs0595) | 617113..617769 | + | 657 | WP_000353149 | ABC transporter ATP-binding protein | - |
| GBS_RS03425 (gbs0596) | 617769..619145 | + | 1377 | WP_000594351 | FtsX-like permease family protein | - |
| GBS_RS03430 (gbs0597) | 619242..619895 | + | 654 | WP_000699093 | response regulator transcription factor | - |
| GBS_RS03435 (gbs0598) | 619892..621211 | + | 1320 | WP_000734169 | HAMP domain-containing sensor histidine kinase | - |
| GBS_RS03440 | 621263..621910 | - | 648 | Protein_596 | IS3 family transposase | - |
| GBS_RS03445 | 622088..622288 | + | 201 | WP_000076708 | CsbD family protein | - |
| GBS_RS11225 | 622330..622518 | + | 189 | WP_000027835 | hypothetical protein | - |
| GBS_RS03450 (gbs0601) | 622943..624148 | + | 1206 | WP_000078931 | FtsW/RodA/SpoVE family cell cycle protein | - |
| GBS_RS03455 (gbs0602) | 624267..624827 | + | 561 | WP_001106189 | HAD-IA family hydrolase | - |
| GBS_RS03460 (gbs0603) | 624828..626780 | + | 1953 | WP_000134196 | DNA topoisomerase (ATP-hydrolyzing) subunit B | - |
| GBS_RS03465 (gbs0604) | 626874..628598 | + | 1725 | WP_000094341 | septation ring formation regulator EzrA | - |
| GBS_RS03470 (gbs0605) | 628692..629333 | + | 642 | WP_000589685 | phosphoserine phosphatase SerB | - |
| GBS_RS03475 (gbs0606) | 629354..629839 | - | 486 | WP_000409124 | NUDIX domain-containing protein | - |
| GBS_RS03480 (gbs0607) | 629852..630307 | - | 456 | WP_000137373 | YueI family protein | - |
| GBS_RS03485 (gbs0608) | 630505..631812 | + | 1308 | WP_000022832 | surface-displayed alpha-enolase | - |
| GBS_RS03490 (gbs0609) | 631920..632984 | - | 1065 | WP_000823931 | DNA/RNA non-specific endonuclease | - |
| GBS_RS03495 (gbs0610) | 633213..634496 | + | 1284 | WP_000772016 | 3-phosphoshikimate 1-carboxyvinyltransferase | - |
| GBS_RS03500 (gbs0611) | 634489..635001 | + | 513 | WP_001127193 | shikimate kinase | - |
| GBS_RS03505 (gbs0612) | 635058..636431 | + | 1374 | WP_000089337 | LCP family protein | - |
| GBS_RS03510 (gbs0613) | 636532..637887 | + | 1356 | WP_000902654 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| GBS_RS03515 (gbs0614) | 637995..638216 | + | 222 | WP_001142755 | helical hairpin domain-containing protein | - |
| GBS_RS03520 (gbs0615) | 638334..639071 | + | 738 | WP_000757296 | acid phosphatase AphA | - |
| GBS_RS03525 (gbs0616) | 639392..639910 | + | 519 | WP_001267096 | ClbS/DfsB family four-helix bundle protein | - |
| GBS_RS11820 | 640039..640227 | - | 189 | WP_001875973 | TetR-like C-terminal domain-containing protein | - |
| GBS_RS11825 | 640256..640564 | - | 309 | WP_001876114 | TetR/AcrR family transcriptional regulator | - |
| GBS_RS03540 (gbs0619) | 640747..641079 | + | 333 | WP_000944932 | YSIRK-type signal peptide-containing protein | - |
| GBS_RS11690 | 642426..642614 | + | 189 | Protein_619 | hypothetical protein | - |
| GBS_RS11235 | 642624..642852 | + | 229 | Protein_620 | plasmid mobilization relaxosome protein MobC | - |
| GBS_RS03555 (gbs0625) | 642854..643349 | - | 496 | Protein_621 | Hsp33 family molecular chaperone HslO | - |
| GBS_RS03560 | 643543..644751 | - | 1209 | Protein_622 | YSIRK-targeted surface antigen transcriptional regulator | - |
| GBS_RS03565 (gbs0628) | 645134..646798 | + | 1665 | WP_000777402 | SpaH/EbpB family LPXTG-anchored major pilin | - |
| GBS_RS03570 (gbs0629) | 646887..647810 | + | 924 | WP_000815035 | SpaA isopeptide-forming pilin-related protein | - |
| GBS_RS03575 (gbs0630) | 647812..648729 | + | 918 | WP_000529916 | class C sortase SrtC1 | - |
| GBS_RS03580 (gbs0631) | 648686..649537 | + | 852 | WP_000746885 | class C sortase SrtC2 | - |
| GBS_RS03585 (gbs0632) | 649619..652291 | + | 2673 | WP_001868236 | SpaA isopeptide-forming pilin-related protein | - |
| GBS_RS03590 | 652332..652934 | + | 603 | Protein_628 | class C sortase | - |
| GBS_RS11830 | 652968..653313 | - | 346 | Protein_629 | transposase | - |
| GBS_RS03595 | 653384..653989 | + | 606 | WP_000090277 | prealbumin-like fold domain-containing protein | - |
| GBS_RS11835 | 654227..654700 | + | 474 | Protein_631 | CHAP domain-containing protein | - |
| GBS_RS11715 | 655087..655263 | + | 177 | WP_000557949 | hypothetical protein | - |
| GBS_RS11840 | 656344..656671 | - | 328 | Protein_633 | transposase | - |
| GBS_RS03610 (gbs0639) | 656683..656877 | + | 195 | WP_223295595 | hypothetical protein | - |
| GBS_RS03615 (gbs0640) | 656938..658089 | + | 1152 | WP_000251790 | serine hydrolase | - |
| GBS_RS03620 (gbs0641) | 658289..659281 | + | 993 | WP_000061734 | ATP-binding cassette domain-containing protein | - |
| GBS_RS03625 (gbs0642) | 659284..660102 | + | 819 | WP_001080088 | ABC-2 family transporter protein | - |
| GBS_RS03630 (gbs0643) | 660104..660889 | + | 786 | WP_000170564 | ABC transporter permease | - |
| GBS_RS03635 (gbs0644) | 661514..661819 | + | 306 | WP_000533775 | hypothetical protein | - |
| GBS_RS03640 (gbs0645) | 661819..662667 | + | 849 | WP_000859501 | hypothetical protein | - |
| GBS_RS03645 (gbs0646) | 662664..663386 | + | 723 | WP_000861302 | 3-oxoacyl-ACP reductase FabG | - |
| GBS_RS03650 (gbs0647) | 663379..663684 | + | 306 | WP_000611493 | phosphopantetheine-binding protein | - |
| GBS_RS03655 (gbs0648) | 663668..664144 | + | 477 | WP_000164166 | 3-hydroxyacyl-ACP dehydratase FabZ | - |
| GBS_RS03660 (gbs0649) | 664134..665063 | + | 930 | WP_000403526 | ABC transporter ATP-binding protein | - |
| GBS_RS03665 (gbs0650) | 665056..665934 | + | 879 | WP_000462410 | ABC transporter permease | - |
| GBS_RS03670 (gbs0651) | 665931..667934 | + | 2004 | WP_000650746 | hypothetical protein | - |
| GBS_RS03675 (gbs0652) | 667931..668884 | + | 954 | WP_001092618 | aminomethyltransferase family protein | - |
| GBS_RS03680 (gbs0653) | 668881..671076 | + | 2196 | WP_000118217 | beta-ketoacyl-[acyl-carrier-protein] synthase family protein | - |
| GBS_RS03685 (gbs0654) | 671081..672292 | + | 1212 | WP_000033003 | glycosyltransferase CylJ | - |
| GBS_RS03690 (gbs0655) | 672261..672836 | + | 576 | WP_001068957 | hypothetical protein | - |
| GBS_RS03695 | 672997..673632 | + | 636 | WP_000251805 | ABC transporter permease | - |
| GBS_RS11780 | 673642..674082 | + | 441 | Protein_652 | hypothetical protein | - |
| GBS_RS11785 | 674170..674430 | + | 261 | Protein_653 | hypothetical protein | - |
| GBS_RS11845 | 674673..674867 | + | 195 | WP_000560511 | hypothetical protein | - |
| GBS_RS03710 (gbs0659) | 675079..675750 | + | 672 | WP_000462434 | ABC transporter ATP-binding protein | - |
| GBS_RS03715 (gbs0660) | 675807..677252 | - | 1446 | WP_000750939 | FAD/NAD(P)-binding protein | - |
| GBS_RS03720 (gbs0661) | 677513..678298 | + | 786 | WP_000825437 | DNA/RNA non-specific endonuclease | - |
| GBS_RS03725 (gbs0662) | 678376..679014 | - | 639 | WP_000478529 | VTT domain-containing protein | - |
| GBS_RS03730 (gbs0663) | 679231..679887 | + | 657 | WP_000121094 | ATP-binding cassette domain-containing protein | - |
| GBS_RS03735 (gbs0664) | 679884..680657 | + | 774 | WP_000011926 | iron export ABC transporter permease subunit FetB | - |
| GBS_RS03740 (gbs0665) | 680821..681639 | + | 819 | WP_000601000 | hypothetical protein | - |
| GBS_RS03745 (gbs0666) | 681676..682560 | - | 885 | WP_000354836 | LysR family transcriptional regulator | - |
| GBS_RS03750 (gbs0667) | 682753..683811 | + | 1059 | WP_001286423 | PTS sugar transporter subunit IIC | - |
| GBS_RS03755 (gbs0668) | 683825..684817 | + | 993 | WP_000770077 | D-lactate dehydrogenase | - |
| GBS_RS03760 (gbs0669) | 685023..686573 | + | 1551 | WP_000416101 | MFS transporter | - |
| GBS_RS03765 (gbs0670) | 686640..687665 | + | 1026 | WP_001062632 | sugar kinase | - |
| GBS_RS03770 (gbs0671) | 687682..689481 | + | 1800 | WP_000966714 | beta-glucuronidase | - |
| GBS_RS03775 (gbs0672) | 689510..690181 | + | 672 | WP_000113632 | FadR/GntR family transcriptional regulator | - |
| GBS_RS03780 (gbs0673) | 690298..690915 | + | 618 | WP_000934331 | bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase | - |
| GBS_RS03785 (gbs0674) | 690932..692332 | + | 1401 | WP_000143785 | glucuronate isomerase | - |
| GBS_RS03790 (gbs0675) | 692350..693396 | + | 1047 | WP_000426044 | mannonate dehydratase | - |
| GBS_RS03795 (gbs0676) | 693520..694359 | + | 840 | WP_000034789 | SDR family oxidoreductase | - |
| GBS_RS03800 (gbs0677) | 694512..695324 | + | 813 | WP_000228641 | HAD hydrolase-like protein | - |
| GBS_RS03805 (gbs0678) | 695340..697130 | + | 1791 | WP_000149451 | glycoside hydrolase family 3 N-terminal domain-containing protein | - |
| GBS_RS03810 (gbs0679) | 697188..698273 | - | 1086 | WP_000040811 | Xaa-Pro peptidase family protein | - |
| GBS_RS03815 (gbs0680) | 698483..699487 | + | 1005 | WP_001090621 | catabolite control protein A | - |
| GBS_RS03820 (gbs0681) | 699619..701085 | + | 1467 | WP_000180582 | alpha-amylase | - |
| GBS_RS03825 (gbs0682) | 701130..702128 | + | 999 | WP_000866345 | glycosyltransferase | - |
| GBS_RS03830 (gbs0683) | 702130..703464 | + | 1335 | WP_001219475 | glycosyltransferase family 4 protein | - |
| GBS_RS03835 (gbs0684) | 703921..705864 | + | 1944 | WP_000591018 | threonine--tRNA ligase | - |
| GBS_RS03840 (gbs0685) | 706086..706790 | + | 705 | WP_001261248 | response regulator transcription factor | - |
| GBS_RS03845 (gbs0686) | 706888..707907 | + | 1020 | WP_001140267 | DUF3114 domain-containing protein | - |
| GBS_RS03850 (gbs0687) | 708074..708640 | + | 567 | WP_000592389 | PepSY domain-containing protein | - |
| GBS_RS03855 (gbs0688) | 708689..709339 | - | 651 | WP_000100034 | amino acid ABC transporter permease | - |
| GBS_RS03860 (gbs0689) | 709351..710046 | - | 696 | WP_000173640 | amino acid ABC transporter permease | - |
| GBS_RS03865 (gbs0690) | 710059..710859 | - | 801 | WP_000946171 | transporter substrate-binding domain-containing protein | - |
| GBS_RS03870 (gbs0691) | 710871..711626 | - | 756 | WP_000053154 | amino acid ABC transporter ATP-binding protein | - |
| GBS_RS03875 (gbs0692) | 711937..712125 | + | 189 | WP_001161739 | hypothetical protein | - |
| GBS_RS03880 (gbs0693) | 712162..712656 | + | 495 | WP_000620669 | hypothetical protein | - |
| GBS_RS03885 (gbs0694) | 712667..712996 | + | 330 | WP_000806219 | hypothetical protein | - |
| GBS_RS03890 (gbs0697) | 713212..713439 | + | 228 | WP_000368981 | hypothetical protein | - |
| GBS_RS03895 (gbs0698) | 713452..714945 | + | 1494 | WP_001091156 | primase C-terminal domain-containing protein | - |
| GBS_RS03900 (gbs0699) | 715201..715404 | + | 204 | WP_000878297 | hypothetical protein | - |
| GBS_RS03905 (gbs0700) | 715431..715844 | + | 414 | WP_000213918 | hypothetical protein | - |
| GBS_RS03910 (gbs0701) | 715844..716290 | + | 447 | WP_000565647 | hypothetical protein | - |
| GBS_RS11925 | 716283..716483 | + | 201 | WP_000609074 | hypothetical protein | - |
| GBS_RS03915 (gbs0702) | 716480..716929 | + | 450 | WP_000606416 | hypothetical protein | - |
| GBS_RS03920 (gbs0703) | 716922..717332 | + | 411 | WP_001085986 | hypothetical protein | - |
| GBS_RS11695 | 717483..717653 | + | 171 | WP_000267908 | hypothetical protein | - |
| GBS_RS03925 (gbs0705) | 717668..717916 | + | 249 | WP_000436120 | hypothetical protein | - |
| GBS_RS03930 (gbs0706) | 717909..718865 | - | 957 | WP_000009663 | hypothetical protein | - |
| GBS_RS03935 (gbs0707) | 718944..719948 | + | 1005 | WP_000566588 | hypothetical protein | - |
| GBS_RS03940 (gbs0708) | 719964..720852 | + | 889 | Protein_703 | hypothetical protein | - |
| GBS_RS03945 (gbs0709) | 720975..721250 | + | 276 | WP_001074442 | hypothetical protein | - |
| GBS_RS03950 (gbs0710) | 721644..721961 | + | 318 | WP_000353210 | hypothetical protein | - |
| GBS_RS03955 (gbs0711) | 721954..722301 | + | 348 | WP_000159504 | hypothetical protein | - |
| GBS_RS03960 (gbs0712) | 722301..723101 | + | 801 | WP_000739634 | DNA/RNA non-specific endonuclease | - |
| GBS_RS03965 (gbs0713) | 723118..723576 | + | 459 | WP_000166256 | hypothetical protein | - |
| GBS_RS03970 (gbs0714) | 723630..725996 | + | 2367 | WP_000383377 | MobP2 family relaxase | - |
| GBS_RS03975 (gbs0715) | 726122..726379 | + | 258 | WP_000965476 | hypothetical protein | - |
| GBS_RS03980 | 726398..731128 | + | 4731 | WP_011074710 | PBECR4 domain-containing protein | - |
| GBS_RS03985 (gbs0717) | 731311..733059 | + | 1749 | WP_000259054 | DNA topoisomerase | - |
| GBS_RS03990 (gbs0718) | 733061..734893 | + | 1833 | WP_011074711 | ATP-dependent Clp protease ATP-binding subunit | - |
| GBS_RS03995 (gbs0719) | 734985..735332 | + | 348 | WP_000797377 | TrbC/VirB2 family protein | virB2 |
| GBS_RS04000 (gbs0720) | 735343..736425 | + | 1083 | WP_000874146 | hypothetical protein | - |
| GBS_RS04005 (gbs0721) | 736440..738701 | + | 2262 | WP_000809481 | C39 family peptidase | - |
| GBS_RS04010 (gbs0722) | 738778..739500 | + | 723 | WP_000163068 | LPXTG cell wall anchor domain-containing protein | prgC |
| GBS_RS04015 (gbs0723) | 739552..742353 | + | 2802 | WP_001087701 | SspB-related isopeptide-forming adhesin | prgB |
| GBS_RS04020 (gbs0724) | 742525..742956 | + | 432 | WP_001154843 | single-stranded DNA-binding protein | - |
| GBS_RS04025 (gbs0725) | 743184..743441 | + | 258 | WP_000047046 | hypothetical protein | - |
| GBS_RS04030 (gbs0726) | 743434..746583 | + | 3150 | WP_000493311 | VirD4-like conjugal transfer protein, CD1115 family | - |
| GBS_RS04035 (gbs0727) | 746683..747165 | + | 483 | WP_000782571 | hypothetical protein | - |
| GBS_RS04040 (gbs0728) | 747285..749492 | + | 2208 | WP_000220530 | pLS20_p028 family conjugation system transmembrane protein | virB6 |
| GBS_RS04045 (gbs0729) | 749501..749782 | + | 282 | WP_000362284 | BRCT domain-containing protein | - |
| GBS_RS04050 (gbs0730) | 750013..750318 | + | 306 | WP_000343797 | DUF5592 family protein | - |
| GBS_RS04055 (gbs0731) | 750318..750965 | + | 648 | WP_000985710 | hypothetical protein | - |
| GBS_RS04060 (gbs0732) | 750975..752924 | + | 1950 | WP_001114671 | virulence factor | - |
| GBS_RS04065 (gbs0733) | 752944..753201 | + | 258 | WP_000078851 | hypothetical protein | - |
| GBS_RS04070 (gbs0734) | 753215..754552 | + | 1338 | WP_000758177 | CHAP domain-containing protein | prgK |
| GBS_RS04075 (gbs0735) | 754566..755150 | + | 585 | WP_000666008 | hypothetical protein | - |
| GBS_RS04080 (gbs0736) | 755289..756107 | + | 819 | WP_001222610 | AAA family ATPase | - |
| GBS_RS04085 (gbs0737) | 756104..756382 | + | 279 | WP_000131727 | hypothetical protein | - |
| GBS_RS04090 (gbs0738) | 756395..756778 | + | 384 | WP_000323828 | replication initiator protein A | - |
| GBS_RS04095 (gbs0739) | 756783..757094 | + | 312 | WP_000583310 | hypothetical protein | - |
| GBS_RS04100 (gbs0740) | 757228..758556 | + | 1329 | WP_000151682 | ISLre2 family transposase | - |
| GBS_RS04105 (gbs0741) | 759044..759754 | + | 711 | WP_000722052 | response regulator YycF | - |
| GBS_RS04110 (gbs0742) | 759747..761096 | + | 1350 | WP_001065469 | cell wall metabolism sensor histidine kinase VicK | - |
| GBS_RS04115 (gbs0743) | 761100..761909 | + | 810 | WP_001289499 | MBL fold metallo-hydrolase | - |
| GBS_RS04120 (gbs0744) | 761912..762280 | + | 369 | WP_000719384 | YbaN family protein | - |
| GBS_RS04125 (gbs0745) | 762456..763142 | + | 687 | WP_000661526 | ribonuclease III | - |
| GBS_RS04130 (gbs0746) | 763150..766689 | + | 3540 | WP_000478794 | chromosome segregation protein SMC | - |
| GBS_RS04135 (gbs0747) | 766780..767577 | + | 798 | WP_000594102 | Cof-type HAD-IIB family hydrolase | - |
| GBS_RS04140 (gbs0748) | 767577..768401 | + | 825 | WP_001280060 | Cof-type HAD-IIB family hydrolase | - |
| GBS_RS04145 (gbs0749) | 768401..770011 | + | 1611 | WP_000522267 | signal recognition particle-docking protein FtsY | - |
| GBS_RS04150 (gbs0750) | 770048..770860 | - | 813 | WP_000617815 | TIGR03943 family protein | - |
| GBS_RS04155 (gbs0751) | 770860..771762 | - | 903 | WP_000350891 | permease | - |
| GBS_RS04160 (gbs0752) | 771768..771896 | - | 129 | WP_001018624 | SPJ_0845 family protein | - |
| GBS_RS04165 (gbs0753) | 772029..773072 | + | 1044 | WP_000571059 | LLM class flavin-dependent oxidoreductase | - |
| GBS_RS04170 (gbs0754) | 773177..775339 | + | 2163 | WP_000429384 | Tex family protein | - |
| GBS_RS04175 (gbs0755) | 775302..775760 | + | 459 | WP_000366646 | SprT family protein | - |
| GBS_RS04180 (gbs0756) | 775841..776104 | + | 264 | WP_000842478 | PspC domain-containing protein | - |
| GBS_RS04185 (gbs0757) | 776332..777267 | + | 936 | WP_000301753 | HPr(Ser) kinase/phosphatase | - |
| GBS_RS04190 (gbs0758) | 777260..778033 | + | 774 | WP_000609732 | prolipoprotein diacylglyceryl transferase | - |
| GBS_RS04195 (gbs0759) | 778048..778446 | + | 399 | WP_000569599 | DUF948 domain-containing protein | - |
| GBS_RS04200 (gbs0760) | 778443..778874 | + | 432 | WP_000039971 | YtxH domain-containing protein | - |
| GBS_RS04205 (gbs0761) | 778915..779190 | - | 276 | WP_000097985 | DUF3270 domain-containing protein | - |
| GBS_RS04210 (gbs0762) | 779530..780456 | + | 927 | WP_000411251 | peptidase U32 family protein | - |
| GBS_RS04215 (gbs0763) | 780586..781872 | + | 1287 | WP_000073157 | U32 family peptidase | - |
| GBS_RS04220 (gbs0764) | 781999..782211 | + | 213 | WP_001288869 | YdbC family protein | - |
| GBS_RS04225 (gbs0765) | 782335..783132 | + | 798 | WP_000618024 | tryptophan-rich sensory protein | - |
| GBS_RS04230 (gbs0766) | 783234..784574 | - | 1341 | WP_001073014 | Nramp family divalent metal transporter | - |
| GBS_RS04235 (gbs0767) | 785303..786412 | + | 1110 | WP_000975991 | bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD | - |
| GBS_RS04240 (gbs0768) | 786393..787043 | + | 651 | WP_000493859 | riboflavin synthase | - |
| GBS_RS04245 (gbs0769) | 787061..788254 | + | 1194 | WP_000885818 | bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II | - |
| GBS_RS04250 (gbs0770) | 788269..788739 | + | 471 | WP_000152414 | 6,7-dimethyl-8-ribityllumazine synthase | - |
| GBS_RS04255 (gbs0771) | 788814..790304 | - | 1491 | WP_000070708 | lysine--tRNA ligase | - |
| GBS_RS04260 (gbs0772) | 790479..791381 | + | 903 | WP_000633102 | HAD family hydrolase | - |
| GBS_RS04265 (gbs0773) | 791417..792058 | - | 642 | WP_000675284 | histidine phosphatase family protein | - |
| GBS_RS04270 (gbs0774) | 792080..792553 | - | 474 | WP_000038843 | aminoacyl-tRNA deacylase | - |
| GBS_RS04275 (gbs0775) | 792848..793465 | + | 618 | WP_000404307 | NAD(P)H-binding protein | - |
| GBS_RS04280 (gbs0776) | 793498..794346 | - | 849 | WP_001254334 | glycoside hydrolase family 25 protein | - |
| GBS_RS04285 (gbs0777) | 794503..795027 | + | 525 | WP_000594806 | ECF transporter S component | - |
| GBS_RS04290 (gbs0778) | 795011..795400 | + | 390 | WP_000759944 | DUF4430 domain-containing protein | - |
| GBS_RS04295 (gbs0779) | 795459..797258 | - | 1800 | WP_000768693 | oligoendopeptidase F | - |
| GBS_RS04300 (gbs0780) | 797467..800262 | + | 2796 | WP_000019267 | phosphoenolpyruvate carboxylase | - |
| GBS_RS04305 (gbs0781) | 800368..801636 | + | 1269 | WP_000687014 | FtsW/RodA/SpoVE family cell cycle protein | - |
| GBS_RS04310 (gbs0782) | 801988..803184 | + | 1197 | WP_001040730 | elongation factor Tu | - |
| GBS_RS04315 (gbs0783) | 803365..804123 | + | 759 | WP_000087883 | triose-phosphate isomerase | - |
| GBS_RS04320 (gbs0784) | 804300..804992 | + | 693 | WP_000240135 | phosphoglycerate mutase | - |
| GBS_RS04325 (gbs0785) | 805121..807166 | + | 2046 | WP_000934666 | penicillin-binding protein PBP2B | - |
| GBS_RS04330 (gbs0786) | 807181..807777 | + | 597 | WP_000966735 | recombination mediator RecR | - |
| GBS_RS04335 (gbs0787) | 807918..808964 | + | 1047 | WP_000032513 | D-alanine--D-alanine ligase | - |
| GBS_RS04340 (gbs0788) | 809111..810478 | + | 1368 | WP_000777517 | UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase | - |
| GBS_RS04345 (gbs0789) | 810665..811885 | + | 1221 | WP_000793481 | OFA family MFS transporter | - |
| GBS_RS04350 (gbs0790) | 812014..812700 | + | 687 | WP_000569006 | YwaF family protein | - |
| GBS_RS04355 (gbs0791) | 812879..814417 | + | 1539 | WP_001043090 | LPXTG cell wall anchor domain-containing protein | - |
| GBS_RS04360 (gbs0792) | 814594..816138 | + | 1545 | WP_000174832 | peptide chain release factor 3 | - |
| GBS_RS04365 (gbs0793) | 816224..816604 | + | 381 | WP_000510901 | PH domain-containing protein | - |
| GBS_RS04370 (gbs0794) | 816725..817459 | + | 735 | WP_000582850 | ATP-binding cassette domain-containing protein | - |
| GBS_RS04375 (gbs0795) | 817452..818114 | + | 663 | WP_000565395 | methionine ABC transporter permease | - |
| GBS_RS04380 (gbs0796) | 818130..818960 | + | 831 | WP_000735504 | MetQ/NlpA family ABC transporter substrate-binding protein | - |
| GBS_RS04385 (gbs0797) | 819195..820781 | + | 1587 | WP_000673089 | DEAD/DEAH box helicase | - |
| GBS_RS04390 (gbs0798) | 820966..821232 | - | 267 | WP_000598736 | GIY-YIG nuclease family protein | - |
| GBS_RS04395 (gbs0799) | 821225..821989 | - | 765 | WP_000567425 | tRNA1(Val) (adenine(37)-N6)-methyltransferase | - |
| GBS_RS04400 (gbs0800) | 822124..822864 | + | 741 | WP_000500220 | 1-acyl-sn-glycerol-3-phosphate acyltransferase | - |
| GBS_RS04405 (gbs0801) | 822964..823617 | + | 654 | WP_000461744 | helix-hairpin-helix domain-containing protein | - |
| GBS_RS04410 (gbs0802) | 823601..825838 | + | 2238 | WP_000939903 | DNA internalization-related competence protein ComEC/Rec2 | - |
| GBS_RS04415 (gbs0803) | 825964..826773 | + | 810 | WP_000153219 | Cof-type HAD-IIB family hydrolase | - |
| GBS_RS04420 (gbs0804) | 826784..827728 | + | 945 | WP_000200830 | LacI family DNA-binding transcriptional regulator | - |
| GBS_RS04425 (gbs0805) | 827787..828779 | - | 993 | WP_000800998 | alpha/beta hydrolase | - |
| GBS_RS04430 (gbs0806) | 828955..829683 | + | 729 | WP_000468966 | methyltransferase domain-containing protein | - |
| GBS_RS04435 (gbs0807) | 829737..830774 | + | 1038 | WP_000560292 | DNA polymerase III subunit delta | - |
| GBS_RS04440 (gbs0808) | 830854..831462 | + | 609 | WP_000974719 | superoxide dismutase SodA | - |
| GBS_RS04445 (gbs0809) | 831800..832651 | + | 852 | WP_000584608 | PRD domain-containing protein | - |
| GBS_RS04450 (gbs0810) | 832644..834512 | + | 1869 | WP_000170543 | PTS beta-glucoside transporter subunit IIBCA | - |
| GBS_RS04455 (gbs0811) | 834529..835956 | + | 1428 | WP_000215675 | glycoside hydrolase family 1 protein | - |
| GBS_RS04460 (gbs0812) | 836025..837119 | - | 1095 | WP_000776696 | sugar diacid recognition domain-containing protein | - |
| GBS_RS04465 (gbs0813) | 837286..838428 | + | 1143 | WP_000869908 | glycerate kinase | - |
| GBS_RS04470 (gbs0814) | 838453..839709 | + | 1257 | WP_000388411 | GntP family permease | - |
| GBS_RS04475 (gbs0815) | 839810..840874 | + | 1065 | WP_000814870 | serine hydrolase | - |
| GBS_RS11895 | 840929..841372 | - | 444 | WP_000606029 | MarR family transcriptional regulator | - |
| GBS_RS04485 (gbs0817) | 841453..842481 | - | 1029 | WP_001095266 | tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA | - |
| GBS_RS04490 (gbs0818) | 842634..843314 | + | 681 | WP_000656582 | VIT family protein | - |
| GBS_RS04495 (gbs0819) | 843465..844166 | + | 702 | WP_001263956 | glucosamine-6-phosphate deaminase | - |
| GBS_RS04500 (gbs0820) | 844238..845194 | - | 957 | WP_000523783 | glutathione S-transferase family protein | - |
| GBS_RS04505 (gbs0821) | 845290..846009 | + | 720 | WP_001234962 | pseudouridine synthase | - |
| GBS_RS04510 (gbs0822) | 846082..847233 | + | 1152 | WP_001086189 | MFS transporter | - |
| GBS_RS04515 (gbs0823) | 847285..848232 | + | 948 | WP_000903650 | competence protein CoiA family protein | - |
| GBS_RS04520 (gbs0824) | 848248..850053 | + | 1806 | WP_001282905 | oligoendopeptidase F | - |
| GBS_RS04525 (gbs0825) | 850248..850874 | + | 627 | WP_000736939 | HAD hydrolase-like protein | - |
| GBS_RS04530 (gbs0826) | 850948..851655 | + | 708 | WP_000250858 | O-methyltransferase | - |
| GBS_RS04535 (gbs0827) | 851716..852645 | + | 930 | WP_000857818 | peptidylprolyl isomerase PrsA | - |
| GBS_RS04540 (gbs0828) | 852887..853372 | + | 486 | WP_000190195 | LURP-one-related family protein | - |
| GBS_RS04545 (gbs0829) | 853388..856006 | + | 2619 | WP_000661545 | alanine--tRNA ligase | - |
| GBS_RS04550 (gbs0830) | 856088..856804 | + | 717 | WP_000232924 | DUF554 domain-containing protein | - |
| GBS_RS04555 (gbs0831) | 856892..857710 | + | 819 | WP_001050374 | glycosyltransferase family 8 protein | - |
| GBS_RS04560 (gbs0832) | 858186..858479 | + | 294 | WP_025194112 | hypothetical protein | - |
| GBS_RS04565 (gbs0833) | 858524..858739 | + | 216 | WP_000522959 | helix-turn-helix transcriptional regulator | - |
| GBS_RS04570 (gbs0834) | 858742..859500 | + | 759 | WP_000651265 | DUF3169 family protein | - |
| GBS_RS04575 (gbs0835) | 859585..860148 | - | 564 | WP_000042136 | energy-coupled thiamine transporter ThiT | - |
| GBS_RS04580 (gbs0836) | 860389..861348 | - | 960 | WP_000214845 | class 1b ribonucleoside-diphosphate reductase subunit beta | - |
| GBS_RS04585 (gbs0837) | 861551..863710 | - | 2160 | WP_000053869 | class 1b ribonucleoside-diphosphate reductase subunit alpha | - |
| GBS_RS04590 | 863788..864012 | - | 225 | WP_000201430 | redoxin NrdH | - |
| GBS_RS04595 (gbs0839) | 864394..864657 | + | 264 | WP_000146945 | phosphocarrier protein HPr | - |
| GBS_RS04600 (gbs0840) | 864662..866395 | + | 1734 | WP_000138155 | phosphoenolpyruvate--protein phosphotransferase | - |
| GBS_RS04605 (gbs0841) | 866545..867972 | + | 1428 | WP_000159915 | NADP-dependent glyceraldehyde-3-phosphate dehydrogenase | - |
| GBS_RS04610 (gbs0842) | 868112..869365 | + | 1254 | WP_000733376 | polysaccharide deacetylase family protein | - |
| GBS_RS04615 (gbs0843) | 869396..870478 | - | 1083 | WP_000628855 | DEAD/DEAH box helicase | - |
| GBS_RS04620 (gbs0844) | 870623..871252 | + | 630 | WP_001227821 | uridine kinase | - |
| GBS_RS04625 (gbs0845) | 871339..871836 | + | 498 | WP_001043212 | GAF domain-containing protein | - |
| GBS_RS04630 (gbs0846) | 871836..873500 | + | 1665 | WP_000283819 | DNA polymerase III subunit gamma/tau | - |
| GBS_RS04635 (gbs0847) | 873589..873783 | + | 195 | WP_000166926 | DUF3272 domain-containing protein | - |
| GBS_RS04640 (gbs0848) | 873764..874699 | - | 936 | WP_001873801 | bifunctional biotin--[acetyl-CoA-carboxylase] ligase/biotin operon repressor BirA | - |
| GBS_RS04645 (gbs0849) | 874884..876080 | + | 1197 | WP_000003964 | methionine adenosyltransferase | - |
| GBS_RS11280 | 876067..876342 | + | 276 | Protein_845 | hypothetical protein | - |
| GBS_RS04650 (gbs0850) | 876599..878506 | + | 1908 | WP_000743858 | fibrinogen-binding surface protein FbsB | - |
| GBS_RS04655 (gbs0851) | 878573..879118 | + | 546 | WP_000724543 | GA module-containing protein | - |
| GBS_RS04660 (gbs0853) | 879514..880080 | + | 567 | WP_000181414 | energy coupling factor transporter S component ThiW | - |
| GBS_RS04665 (gbs0854) | 880077..880631 | + | 555 | WP_000766003 | ECF transporter S component | - |
| GBS_RS04670 (gbs0855) | 880635..881921 | + | 1287 | WP_000953607 | ATP-binding cassette domain-containing protein | - |
| GBS_RS04675 (gbs0856) | 881909..882573 | + | 665 | Protein_851 | energy-coupling factor transporter transmembrane component T | - |
| GBS_RS04680 (gbs0857) | 882657..883336 | + | 680 | Protein_852 | thiaminase II | - |
| GBS_RS04685 (gbs0858) | 883338..884135 | + | 798 | WP_000221573 | bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase | - |
| GBS_RS04690 (gbs0859) | 884137..884907 | + | 771 | WP_000280427 | hydroxyethylthiazole kinase | - |
| GBS_RS04695 (gbs0860) | 884921..885592 | + | 672 | WP_000655659 | thiamine phosphate synthase | - |
| GBS_RS04700 (gbs0861) | 885719..886978 | + | 1260 | WP_001226236 | UDP-N-acetylglucosamine 1-carboxyvinyltransferase | - |
| GBS_RS04705 (gbs0862) | 887080..887634 | + | 555 | WP_000355951 | GNAT family protein | - |
| GBS_RS04710 (gbs0863) | 887627..888910 | + | 1284 | WP_000033796 | CBS-HotDog domain-containing transcription factor SpxR | - |
| GBS_RS04715 (gbs0864) | 888933..889793 | + | 861 | WP_000631567 | methionyl aminopeptidase | - |
| GBS_RS04720 (gbs0865) | 889795..890715 | + | 921 | WP_000768440 | YihY/virulence factor BrkB family protein | - |
| GBS_RS04725 (gbs0866) | 890732..891187 | - | 456 | WP_000239854 | GtrA family protein | - |
| GBS_RS04730 (gbs0867) | 891369..891878 | + | 510 | WP_001091613 | QueT transporter family protein | - |
| GBS_RS04735 (gbs0868) | 892018..893976 | + | 1959 | WP_001873803 | NAD-dependent DNA ligase LigA | - |
| GBS_RS04740 (gbs0869) | 893988..895007 | + | 1020 | WP_000744288 | diacylglycerol kinase family lipid kinase | - |
| GBS_RS04745 (gbs0870) | 895011..897311 | + | 2301 | WP_000370738 | type I pullulanase | - |
| GBS_RS04750 (gbs0871) | 897517..899385 | + | 1869 | WP_000066071 | 1,4-alpha-glucan branching protein GlgB | - |
| GBS_RS04755 (gbs0872) | 899427..900566 | + | 1140 | WP_000787289 | glucose-1-phosphate adenylyltransferase | - |
| GBS_RS04760 (gbs0873) | 900556..901689 | + | 1134 | WP_000687079 | glucose-1-phosphate adenylyltransferase subunit GlgD | - |
| GBS_RS04765 (gbs0874) | 901686..903116 | + | 1431 | WP_000699871 | glycogen synthase GlgA | - |
| GBS_RS04770 (gbs0875) | 903448..903648 | + | 201 | WP_001046538 | F0F1 ATP synthase subunit C | - |
| GBS_RS04775 (gbs0876) | 903681..904397 | + | 717 | WP_000446423 | F0F1 ATP synthase subunit A | - |
| GBS_RS04780 (gbs0877) | 904415..904912 | + | 498 | WP_000025478 | F0F1 ATP synthase subunit B | - |
| GBS_RS04785 (gbs0878) | 904912..905448 | + | 537 | WP_001036760 | F0F1 ATP synthase subunit delta | - |
| GBS_RS04790 (gbs0879) | 905464..906969 | + | 1506 | WP_000996611 | F0F1 ATP synthase subunit alpha | - |
| GBS_RS04795 (gbs0880) | 906985..907866 | + | 882 | WP_000919082 | F0F1 ATP synthase subunit gamma | - |
| GBS_RS04800 (gbs0881) | 907940..909346 | + | 1407 | WP_000094377 | F0F1 ATP synthase subunit beta | - |
| GBS_RS04805 (gbs0882) | 909359..909772 | + | 414 | WP_000068053 | F0F1 ATP synthase subunit epsilon | - |
| GBS_RS04810 | 909837..910067 | + | 231 | WP_000602601 | DUF1146 family protein | - |
| GBS_RS04815 (gbs0883) | 910130..911401 | + | 1272 | WP_000357880 | UDP-N-acetylglucosamine 1-carboxyvinyltransferase | - |
| GBS_RS04820 (gbs0884) | 911403..911594 | + | 192 | WP_000168511 | DNA-directed RNA polymerase subunit beta | - |
| GBS_RS04825 (gbs0885) | 911669..912526 | + | 858 | WP_000163019 | DNA/RNA non-specific endonuclease | - |
| GBS_RS04830 (gbs0886) | 912817..913857 | + | 1041 | WP_000365658 | phenylalanine--tRNA ligase subunit alpha | - |
| GBS_RS04835 (gbs0887) | 913940..914461 | + | 522 | WP_000078403 | GNAT family N-acetyltransferase | - |
| GBS_RS04840 (gbs0888) | 914515..916920 | + | 2406 | WP_000961585 | phenylalanine--tRNA ligase subunit beta | - |
| GBS_RS04845 | 916989..917594 | - | 606 | Protein_885 | neutral zinc metallopeptidase | - |
| GBS_RS04850 (gbs0890) | 917768..921001 | + | 3234 | WP_000772291 | ATP-dependent nuclease subunit B | - |
| GBS_RS04855 (gbs0891) | 920991..924614 | + | 3624 | WP_000143226 | helicase-exonuclease AddAB subunit AddA | - |
| GBS_RS04860 (gbs0892) | 924627..925553 | + | 927 | WP_000634647 | magnesium transporter CorA family protein | - |
| GBS_RS04865 (gbs0893) | 925528..926904 | - | 1377 | WP_000028890 | tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE | - |
| GBS_RS04870 (gbs0894) | 927032..928942 | + | 1911 | WP_000584919 | ABC-F family ATP-binding cassette domain-containing protein | - |
| GBS_RS04875 (gbs0895) | 929091..930059 | + | 969 | WP_000258166 | thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha | - |
| GBS_RS04880 (gbs0896) | 930134..931132 | + | 999 | WP_000005088 | alpha-ketoacid dehydrogenase subunit beta | - |
| GBS_RS04885 (gbs0897) | 931259..932647 | + | 1389 | WP_000257571 | dihydrolipoamide acetyltransferase | - |
| GBS_RS04890 (gbs0898) | 932707..934464 | + | 1758 | WP_000863368 | dihydrolipoyl dehydrogenase | - |
| GBS_RS04895 (gbs0899) | 934562..935551 | + | 990 | WP_000875296 | lipoate--protein ligase | - |
| GBS_RS04900 (gbs0900) | 935658..936443 | - | 786 | WP_000222746 | lipid II isoglutaminyl synthase subunit GatD | - |
| GBS_RS04905 (gbs0901) | 936443..937786 | - | 1344 | WP_000700877 | lipid II isoglutaminyl synthase subunit MurT | - |
| GBS_RS04910 (gbs0902) | 937926..938777 | + | 852 | WP_000350949 | diadenylate cyclase CdaA | - |
| GBS_RS04915 (gbs0903) | 938780..939739 | + | 960 | WP_000713236 | CdaR family protein | - |
| GBS_RS04920 (gbs0904) | 939793..941145 | + | 1353 | WP_000521427 | phosphoglucosamine mutase | - |
| GBS_RS04925 (gbs0905) | 941268..941639 | + | 372 | WP_000159235 | YbgA family protein | - |
| GBS_RS04930 (gbs0906) | 941664..942044 | + | 381 | WP_001241816 | TIGR02328 family protein | - |
| GBS_RS04935 (gbs0907) | 942136..943266 | + | 1131 | WP_000914658 | radical SAM family heme chaperone HemW | - |
| GBS_RS04940 (gbs0908) | 943270..944007 | + | 738 | WP_000523795 | acyl-ACP thioesterase domain-containing protein | - |
| GBS_RS04945 (gbs0909) | 944008..944778 | + | 771 | WP_000323544 | TIGR01457 family HAD-type hydrolase | - |
| GBS_RS04950 (gbs0910) | 944768..945424 | + | 657 | WP_000653350 | TIGR01906 family membrane protein | - |
| GBS_RS04955 (gbs0911) | 945813..949946 | + | 4134 | WP_001040103 | type II CRISPR RNA-guided endonuclease Cas9 | - |
| GBS_RS04960 (gbs0912) | 949948..950817 | + | 870 | WP_000929490 | type II CRISPR-associated endonuclease Cas1 | - |
| GBS_RS04965 (gbs0913) | 950814..951155 | + | 342 | WP_000122197 | CRISPR-associated endonuclease Cas2 | - |
| GBS_RS04970 (gbs0914) | 951142..951807 | + | 666 | WP_000590706 | type II-A CRISPR-associated protein Csn2 | - |
| GBS_RS04975 (gbs0915) | 952854..953114 | + | 261 | WP_000900527 | hypothetical protein | - |
| GBS_RS04980 (gbs0916) | 953424..953840 | + | 417 | WP_000438311 | nucleoside-diphosphate kinase | - |
| GBS_RS04985 (gbs0917) | 953976..955808 | + | 1833 | WP_001019133 | translation elongation factor 4 | - |
| GBS_RS04990 (gbs0918) | 956054..958687 | + | 2634 | WP_000678286 | pneumococcal-type histidine triad protein | - |
| GBS_RS04995 (gbs0919) | 958787..959446 | + | 660 | WP_000180008 | HD domain-containing protein | - |
| GBS_RS05000 (gbs0920) | 959455..959919 | + | 465 | WP_000621139 | GNAT family N-acetyltransferase | - |
| GBS_RS05005 (gbs0921) | 959919..960353 | + | 435 | WP_000665410 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| GBS_RS05010 (gbs0922) | 960505..963297 | + | 2793 | WP_000168894 | cation-transporting P-type ATPase | - |
| GBS_RS05015 (gbs0923) | 963297..964400 | + | 1104 | WP_000065320 | DUF2974 domain-containing protein | - |
| GBS_RS05020 (gbs0924) | 964521..965090 | - | 570 | WP_000103052 | CatB-related O-acetyltransferase | - |
| GBS_RS05025 (gbs0925) | 965869..966480 | + | 612 | WP_001056394 | TVP38/TMEM64 family protein | - |
| GBS_RS05030 (gbs0926) | 966516..967298 | - | 783 | WP_000467144 | hypothetical protein | - |
| GBS_RS05035 (gbs0927) | 967310..968008 | - | 699 | WP_000192686 | ABC transporter ATP-binding protein | - |
| GBS_RS05040 (gbs0928) | 968009..968377 | - | 369 | WP_000312256 | GntR family transcriptional regulator | - |
| GBS_RS05045 (gbs0929) | 968522..971626 | + | 3105 | WP_000457960 | DNA polymerase III subunit alpha | - |
| GBS_RS05050 (gbs0930) | 971707..972729 | + | 1023 | WP_000820831 | 6-phosphofructokinase | - |
| GBS_RS05055 (gbs0931) | 972778..974280 | + | 1503 | WP_001042784 | pyruvate kinase | - |
| GBS_RS05060 (gbs0932) | 974451..975008 | + | 558 | WP_000240773 | signal peptidase I | - |
| GBS_RS05065 (gbs0933) | 975266..977080 | + | 1815 | WP_000334317 | glutamine--fructose-6-phosphate transaminase (isomerizing) | - |
| GBS_RS05070 (gbs0934) | 977242..977571 | + | 330 | WP_000056782 | zinc ribbon domain-containing protein YjdM | - |
| GBS_RS05075 (gbs0935) | 977706..978347 | + | 642 | WP_000120401 | amino acid ABC transporter permease | - |
| GBS_RS05080 (gbs0936) | 978358..978987 | + | 630 | WP_000891273 | amino acid ABC transporter ATP-binding protein | - |
| GBS_RS05085 (gbs0937) | 979001..979834 | + | 834 | WP_000955379 | amino acid ABC transporter substrate-binding protein | - |
| GBS_RS05090 | 979919..980167 | - | 249 | WP_001872296 | 30S ribosomal protein S20 | - |
| GBS_RS05095 (gbs0939) | 980221..981141 | - | 921 | WP_001058331 | type I pantothenate kinase | - |
| GBS_RS05100 (gbs0940) | 981247..981837 | + | 591 | WP_000002661 | class I SAM-dependent methyltransferase | - |
| GBS_RS05105 (gbs0941) | 982163..982552 | + | 390 | WP_000526762 | cytidine deaminase | - |
| GBS_RS05110 (gbs0942) | 982617..983666 | + | 1050 | WP_001034779 | BMP family protein | - |
| GBS_RS05115 (gbs0943) | 983811..985346 | + | 1536 | WP_000193235 | ABC transporter ATP-binding protein | - |
| GBS_RS05120 (gbs0944) | 985339..986400 | + | 1062 | WP_000036990 | ABC transporter permease | - |
| GBS_RS05125 (gbs0945) | 986402..987358 | + | 957 | WP_000060306 | ABC transporter permease | - |
| GBS_RS05130 (gbs0946) | 987564..988934 | + | 1371 | WP_000036813 | FAD-dependent oxidoreductase | - |
| GBS_RS05135 (gbs0947) | 989054..990043 | - | 990 | WP_000127487 | L-lactate dehydrogenase | - |
| GBS_RS05140 (gbs0948) | 990282..992741 | + | 2460 | WP_001152978 | DNA gyrase subunit A | - |
| GBS_RS05145 (gbs0949) | 992748..993491 | + | 744 | WP_001244677 | class A sortase | - |
| GBS_RS05150 (gbs0950) | 993507..993920 | + | 414 | WP_000767935 | VOC family protein | - |
| GBS_RS05155 (gbs0951) | 994074..995036 | + | 963 | WP_000023418 | DUF1002 domain-containing protein | - |
| GBS_RS05160 (gbs0952) | 995100..996227 | - | 1128 | WP_000547446 | cation:proton antiporter | - |
| GBS_RS05165 (gbs0953) | 996497..998059 | - | 1563 | WP_000129872 | glutamine-hydrolyzing GMP synthase | - |
| GBS_RS05170 (gbs0954) | 998272..998970 | + | 699 | WP_000936162 | GntR family transcriptional regulator | - |
| GBS_RS05175 (gbs0955) | 999084..1000418 | + | 1335 | WP_000083753 | methylenetetrahydrofolate--tRNA-(uracil(54)- C(5))-methyltransferase (FADH(2)-oxidizing) TrmFO | - |
| GBS_RS05180 (gbs0956) | 1000496..1001239 | + | 744 | WP_000559005 | GNAT family N-acetyltransferase | - |
| GBS_RS05185 (gbs0957) | 1001372..1002220 | + | 849 | WP_000694284 | MetQ/NlpA family ABC transporter substrate-binding protein | - |
| GBS_RS05190 (gbs0958) | 1002252..1002740 | - | 489 | WP_001140791 | PASTA domain-containing protein | - |
| GBS_RS05195 | 1002906..1003867 | + | 962 | Protein_955 | S41 family peptidase | - |
| GBS_RS05200 (gbs0961) | 1003893..1004645 | + | 753 | WP_000923535 | ABC transporter ATP-binding protein | - |
| GBS_RS05205 (gbs0962) | 1004647..1006602 | + | 1956 | WP_000499555 | FtsX-like permease family protein | - |
| GBS_RS05210 (gbs0963) | 1006712..1007380 | + | 669 | WP_000076365 | response regulator transcription factor | - |
| GBS_RS05215 (gbs0964) | 1007377..1008315 | + | 939 | WP_000620983 | sensor histidine kinase | - |
| GBS_RS05220 (gbs0965) | 1008358..1009428 | - | 1071 | WP_000817930 | tyrosine recombinase XerS | - |
| GBS_RS05225 (gbs0966) | 1009881..1011476 | + | 1596 | WP_000093958 | peptide ABC transporter substrate-binding protein | - |
| GBS_RS05230 (gbs0967) | 1011509..1012282 | - | 774 | WP_000622398 | DUF3307 domain-containing protein | - |
| GBS_RS05235 (gbs0968) | 1012272..1012958 | - | 687 | WP_000280305 | SatD family protein | - |
| GBS_RS05240 (gbs0969) | 1013361..1014689 | - | 1329 | WP_000151682 | ISLre2 family transposase | - |
| GBS_RS05245 (gbs0970) | 1014823..1015134 | - | 312 | WP_000583310 | hypothetical protein | - |
| GBS_RS05250 (gbs0971) | 1015139..1015522 | - | 384 | WP_000323828 | replication initiator protein A | - |
| GBS_RS05255 (gbs0972) | 1015535..1015813 | - | 279 | WP_000131727 | hypothetical protein | - |
| GBS_RS05260 (gbs0973) | 1015810..1016628 | - | 819 | WP_001222610 | AAA family ATPase | - |
| GBS_RS05265 (gbs0974) | 1016767..1017351 | - | 585 | WP_000666008 | hypothetical protein | - |
| GBS_RS05270 (gbs0975) | 1017365..1018702 | - | 1338 | WP_000758177 | CHAP domain-containing protein | prgK |
| GBS_RS05275 (gbs0976) | 1018716..1018973 | - | 258 | WP_000078851 | hypothetical protein | - |
| GBS_RS05280 (gbs0977) | 1018993..1020942 | - | 1950 | WP_001114671 | virulence factor | - |
| GBS_RS05285 (gbs0978) | 1020952..1021599 | - | 648 | WP_000985710 | hypothetical protein | - |
| GBS_RS05290 (gbs0979) | 1021599..1021904 | - | 306 | WP_000343797 | DUF5592 family protein | - |
| GBS_RS05295 (gbs0980) | 1022135..1022416 | - | 282 | WP_000362284 | BRCT domain-containing protein | - |
| GBS_RS05300 (gbs0981) | 1022425..1024632 | - | 2208 | WP_000220530 | pLS20_p028 family conjugation system transmembrane protein | virB6 |
| GBS_RS05305 (gbs0982) | 1024752..1025234 | - | 483 | WP_000782571 | hypothetical protein | - |
| GBS_RS05310 (gbs0983) | 1025334..1028483 | - | 3150 | WP_000493311 | VirD4-like conjugal transfer protein, CD1115 family | - |
| GBS_RS05315 (gbs0984) | 1028476..1028733 | - | 258 | WP_000047046 | hypothetical protein | - |
| GBS_RS05320 (gbs0985) | 1028961..1029392 | - | 432 | WP_001154843 | single-stranded DNA-binding protein | - |
| GBS_RS05325 (gbs0986) | 1029564..1032365 | - | 2802 | WP_001087701 | SspB-related isopeptide-forming adhesin | prgB |
| GBS_RS05330 (gbs0987) | 1032417..1033139 | - | 723 | WP_000163068 | LPXTG cell wall anchor domain-containing protein | prgC |
| GBS_RS05335 (gbs0988) | 1033216..1035477 | - | 2262 | WP_000809481 | C39 family peptidase | - |
| GBS_RS05340 (gbs0989) | 1035492..1036574 | - | 1083 | WP_000874146 | hypothetical protein | - |
| GBS_RS05345 (gbs0990) | 1036585..1036932 | - | 348 | WP_000797377 | TrbC/VirB2 family protein | virB2 |
| GBS_RS05350 (gbs0991) | 1037024..1038856 | - | 1833 | WP_011074711 | ATP-dependent Clp protease ATP-binding subunit | - |
| GBS_RS05355 (gbs0992) | 1038858..1040606 | - | 1749 | WP_000259054 | DNA topoisomerase | - |
| GBS_RS05360 | 1040789..1045519 | - | 4731 | WP_011074710 | PBECR4 domain-containing protein | - |
| GBS_RS05365 (gbs0994) | 1045538..1045795 | - | 258 | WP_000965476 | hypothetical protein | - |
| GBS_RS05370 (gbs0995) | 1045921..1048287 | - | 2367 | WP_000383377 | MobP2 family relaxase | - |
| GBS_RS05375 (gbs0996) | 1048341..1048799 | - | 459 | WP_000166256 | hypothetical protein | - |
| GBS_RS05380 (gbs0997) | 1048816..1049616 | - | 801 | WP_000739634 | DNA/RNA non-specific endonuclease | - |
| GBS_RS05385 (gbs0998) | 1049616..1049963 | - | 348 | WP_000159504 | hypothetical protein | - |
| GBS_RS05390 (gbs0999) | 1049956..1050273 | - | 318 | WP_000353210 | hypothetical protein | - |
| GBS_RS05395 (gbs1000) | 1050667..1050942 | - | 276 | WP_001074442 | hypothetical protein | - |
| GBS_RS05400 (gbs1001) | 1051065..1051953 | - | 889 | Protein_996 | hypothetical protein | - |
| GBS_RS05405 (gbs1002) | 1051969..1052973 | - | 1005 | WP_000566588 | hypothetical protein | - |
| GBS_RS05410 (gbs1003) | 1053052..1054008 | + | 957 | WP_000009663 | hypothetical protein | - |
| GBS_RS05415 (gbs1004) | 1054001..1054249 | - | 249 | WP_000436120 | hypothetical protein | - |
| GBS_RS11700 | 1054264..1054434 | - | 171 | WP_000267908 | hypothetical protein | - |
| GBS_RS05420 (gbs1006) | 1054585..1054995 | - | 411 | WP_001085986 | hypothetical protein | - |
| GBS_RS05425 (gbs1007) | 1054988..1055437 | - | 450 | WP_000606416 | hypothetical protein | - |
| GBS_RS11930 | 1055434..1055634 | - | 201 | WP_000609074 | hypothetical protein | - |
| GBS_RS05435 (gbs1008) | 1055627..1056073 | - | 447 | WP_000565647 | hypothetical protein | - |
| GBS_RS05440 (gbs1009) | 1056073..1056486 | - | 414 | WP_000213918 | hypothetical protein | - |
| GBS_RS05445 (gbs0368) | 1056513..1056716 | - | 204 | WP_000878297 | hypothetical protein | - |
| GBS_RS05450 (gbs1010) | 1056972..1058465 | - | 1494 | WP_001091156 | primase C-terminal domain-containing protein | - |
| GBS_RS05455 (gbs1011) | 1058478..1058705 | - | 228 | WP_000368981 | hypothetical protein | - |
| GBS_RS05460 (gbs1014) | 1058921..1059250 | - | 330 | WP_000806219 | hypothetical protein | - |
| GBS_RS05465 (gbs1015) | 1059261..1059755 | - | 495 | WP_000620669 | hypothetical protein | - |
| GBS_RS05470 (gbs1016) | 1059792..1059980 | - | 189 | WP_001161739 | hypothetical protein | - |
| GBS_RS05475 (gbs1017) | 1060102..1061667 | - | 1566 | WP_000863589 | signal recognition particle protein | - |
| GBS_RS05480 (gbs1018) | 1061685..1062017 | - | 333 | WP_000402075 | putative DNA-binding protein | - |
| GBS_RS05485 (gbs1019) | 1062106..1063419 | - | 1314 | WP_000042576 | HAMP domain-containing sensor histidine kinase | - |
| GBS_RS05490 (gbs1020) | 1063403..1064083 | - | 681 | WP_000590620 | response regulator transcription factor | - |
| GBS_RS05495 (gbs1021) | 1064245..1066794 | - | 2550 | WP_000859383 | M1 family metallopeptidase | - |
| GBS_RS05500 (gbs1022) | 1066940..1067593 | - | 654 | WP_000946330 | phosphate signaling complex protein PhoU | - |
| GBS_RS05505 (gbs1023) | 1067627..1068385 | - | 759 | WP_000193363 | phosphate ABC transporter ATP-binding protein PstB | - |
| GBS_RS05510 (gbs1024) | 1068397..1069200 | - | 804 | WP_000852851 | phosphate ABC transporter ATP-binding protein PstB | - |
| GBS_RS05515 (gbs1025) | 1069212..1070099 | - | 888 | WP_000992189 | phosphate ABC transporter permease PstA | - |
| GBS_RS05520 (gbs1026) | 1070089..1071006 | - | 918 | WP_000795716 | phosphate ABC transporter permease subunit PstC | - |
| GBS_RS05525 (gbs1027) | 1071052..1071918 | - | 867 | WP_001873504 | phosphate ABC transporter substrate-binding protein PstS family protein | - |
| GBS_RS05530 (gbs1028) | 1072097..1073407 | - | 1311 | WP_000775401 | RsmB/NOP family class I SAM-dependent RNA methyltransferase | - |
| GBS_RS05535 (gbs1029) | 1073475..1074239 | - | 765 | WP_000338947 | inositol monophosphatase family protein | - |
| GBS_RS05540 (gbs1030) | 1074229..1074510 | - | 282 | WP_000625906 | UPF0223 family protein | - |
| GBS_RS05545 (gbs1031) | 1074503..1074916 | - | 414 | WP_000631264 | Spx/MgsR family RNA polymerase-binding regulatory protein | - |
| GBS_RS05550 (gbs1032) | 1074959..1075891 | - | 933 | WP_000690921 | bifunctional riboflavin kinase/FAD synthetase | - |
| GBS_RS05555 (gbs1033) | 1075904..1076788 | - | 885 | WP_001873502 | tRNA pseudouridine(55) synthase TruB | - |
| GBS_RS05560 (gbs1034) | 1076880..1077311 | - | 432 | WP_000702703 | GNAT family N-acetyltransferase | - |
| GBS_RS05565 (gbs1035) | 1077324..1078595 | - | 1272 | WP_001002583 | DUF2130 domain-containing protein | - |
| GBS_RS05570 (gbs1036) | 1078629..1079219 | - | 591 | WP_001135934 | restriction endonuclease subunit S | - |
| GBS_RS05575 (gbs1037) | 1079326..1080204 | - | 879 | WP_001209257 | type II CAAX endopeptidase family protein | - |
| GBS_RS05580 (gbs1038) | 1080310..1082940 | - | 2631 | WP_000520617 | ABC transporter permease | - |
| GBS_RS05585 (gbs1039) | 1082952..1083653 | - | 702 | WP_000120355 | ABC transporter ATP-binding protein | - |
| GBS_RS05590 (gbs1040) | 1083790..1085910 | - | 2121 | WP_000246601 | type I DNA topoisomerase | - |
| GBS_RS05595 (gbs1041) | 1086005..1086847 | - | 843 | WP_001015250 | DNA-processing protein DprA | - |
| GBS_RS05600 (gbs1042) | 1086985..1088013 | - | 1029 | WP_000162771 | siderophore ABC transporter substrate-binding protein | - |
| GBS_RS05605 (gbs1043) | 1088075..1088836 | - | 762 | WP_000614751 | ATP-binding cassette domain-containing protein | - |
| GBS_RS05610 (gbs1044) | 1088833..1089807 | - | 975 | WP_000588576 | iron chelate uptake ABC transporter family permease subunit | - |
| GBS_RS05615 (gbs1045) | 1089804..1090766 | - | 963 | WP_000735588 | iron chelate uptake ABC transporter family permease subunit | - |
| GBS_RS05620 (gbs1046) | 1091005..1091553 | - | 549 | WP_000136509 | sugar O-acetyltransferase | - |
| GBS_RS05625 (gbs1047) | 1091574..1092335 | - | 762 | WP_000201088 | ribonuclease HII | - |
| GBS_RS05630 (gbs1048) | 1092322..1093173 | - | 852 | WP_000201281 | ribosome biogenesis GTPase YlqF | - |
| GBS_RS05635 (gbs1049) | 1093449..1094021 | - | 573 | WP_001231800 | L,D-transpeptidase | - |
| GBS_RS05640 (gbs1050) | 1094222..1095706 | - | 1485 | WP_000256015 | carbon starvation CstA family protein | - |
| GBS_RS05645 (gbs1051) | 1095862..1096596 | - | 735 | WP_000866959 | response regulator transcription factor LtdR | - |
| GBS_RS05650 (gbs1052) | 1096608..1098347 | - | 1740 | WP_000171904 | sensor histidine kinase | - |
| GBS_RS11300 | 1098883..1099005 | - | 123 | WP_000472358 | lipoprotein | - |
| GBS_RS11720 | 1099473..1099652 | - | 180 | Protein_1049 | DUF4176 domain-containing protein | - |
| GBS_RS05655 (gbs1053) | 1099892..1100269 | - | 378 | WP_000479582 | hypothetical protein | - |
| GBS_RS05660 (gbs1055) | 1100658..1100981 | - | 324 | WP_001057649 | hypothetical protein | - |
| GBS_RS05665 (gbs1056) | 1101329..1101862 | - | 534 | WP_000526054 | hypothetical protein | - |
| GBS_RS05670 (gbs1057) | 1102010..1102552 | - | 543 | WP_001875989 | hypothetical protein | - |
| GBS_RS05675 | 1102557..1103006 | - | 450 | WP_001867149 | hypothetical protein | - |
| GBS_RS05680 | 1103401..1103661 | - | 261 | WP_001866146 | CHAP domain-containing protein | - |
| GBS_RS05685 | 1103654..1104460 | - | 807 | WP_223297774 | hypothetical protein | - |
| GBS_RS05690 (gbs1061) | 1104469..1104897 | - | 429 | WP_000710901 | hypothetical protein | - |
| GBS_RS05695 (gbs1062) | 1105024..1105278 | - | 255 | WP_000357796 | DUF4176 domain-containing protein | - |
| GBS_RS05700 (gbs1063) | 1105299..1105889 | - | 591 | WP_000581833 | hypothetical protein | - |
| GBS_RS05705 (gbs1064) | 1105903..1106208 | - | 306 | WP_000847738 | hypothetical protein | - |
| GBS_RS05710 (gbs1065) | 1106337..1107251 | - | 915 | WP_001891903 | hypothetical protein | - |
| GBS_RS05715 (gbs1066) | 1107254..1107610 | - | 357 | WP_000140208 | hypothetical protein | - |
| GBS_RS05720 (gbs1067) | 1107622..1107972 | - | 351 | WP_001063013 | TIGR04197 family type VII secretion effector | - |
| GBS_RS05725 (gbs1068) | 1107986..1111915 | - | 3930 | WP_001875988 | type VII secretion protein EssC | - |
| GBS_RS05730 (gbs1069) | 1111890..1112393 | - | 504 | WP_001875987 | cell division protein FtsK | - |
| GBS_RS05735 (gbs1070) | 1112400..1113674 | - | 1275 | WP_000447056 | type VII secretion protein EssB | - |
| GBS_RS05740 (gbs1071) | 1113674..1113916 | - | 243 | WP_001091721 | EsaB/YukD family protein | - |
| GBS_RS05745 (gbs1072) | 1113900..1114373 | - | 474 | WP_000769477 | type VII secretion protein EssA | - |
| GBS_RS05750 (gbs1073) | 1114382..1117393 | - | 3012 | WP_000828097 | type VII secretion protein EsaA | - |
| GBS_RS05755 | 1117475..1117765 | - | 291 | WP_000057251 | WXG100 family type VII secretion target | - |
| GBS_RS05760 (gbs1075) | 1117882..1118664 | - | 783 | WP_000611754 | WxcM-like domain-containing protein | - |
| GBS_RS05765 (gbs1076) | 1118661..1118984 | - | 324 | WP_000921241 | hypothetical protein | - |
| GBS_RS05770 (gbs1077) | 1119111..1122293 | - | 3183 | WP_001126464 | carbamoyl-phosphate synthase large subunit | - |
| GBS_RS05775 (gbs1078) | 1122324..1123400 | - | 1077 | WP_000826109 | carbamoyl phosphate synthase small subunit | - |
| GBS_RS05780 (gbs1079) | 1123414..1124337 | - | 924 | WP_001016473 | aspartate carbamoyltransferase catalytic subunit | - |
| GBS_RS05785 (gbs1080) | 1124502..1125794 | - | 1293 | WP_000275479 | dihydroorotase | - |
| GBS_RS05790 (gbs1081) | 1125806..1126435 | - | 630 | WP_000362328 | orotate phosphoribosyltransferase | - |
| GBS_RS05795 (gbs1082) | 1126448..1127149 | - | 702 | WP_000890175 | orotidine-5'-phosphate decarboxylase | - |
| GBS_RS05800 (gbs1083) | 1127362..1128594 | - | 1233 | WP_001178657 | threonine/serine exporter family protein | - |
| GBS_RS05805 (gbs1084) | 1128634..1130175 | - | 1542 | WP_000025416 | ABC-F family ATP-binding cassette domain-containing protein | - |
| GBS_RS05810 (gbs1085) | 1130306..1130644 | - | 339 | WP_001165747 | ATP cone domain-containing protein | - |
| GBS_RS05815 (gbs1086) | 1130814..1131890 | - | 1077 | WP_000542446 | aspartate-semialdehyde dehydrogenase | - |
| GBS_RS05820 (gbs1087) | 1132099..1133331 | - | 1233 | WP_000482192 | fibrinogen-binding adhesin FbsA | - |
| GBS_RS05825 (gbs1088) | 1134016..1135611 | - | 1596 | WP_000638282 | cardiolipin synthase | - |
| GBS_RS05830 (gbs1089) | 1135730..1137400 | - | 1671 | WP_000845316 | formate--tetrahydrofolate ligase | - |
| GBS_RS05835 (gbs1090) | 1137489..1138508 | - | 1020 | WP_000280825 | lipoate--protein ligase | - |
| GBS_RS05840 (gbs1091) | 1138535..1139413 | - | 879 | WP_000219401 | NAD-dependent deacetylase | - |
| GBS_RS05845 (gbs1092) | 1139382..1140200 | - | 819 | WP_001133610 | protein-ADP-ribose hydrolase | - |
| GBS_RS05850 (gbs1093) | 1140193..1140525 | - | 333 | WP_000717327 | glycine cleavage system protein H | - |
| GBS_RS05855 (gbs1094) | 1140554..1141540 | - | 987 | WP_000778224 | MsnO8 family LLM class oxidoreductase | - |
| GBS_RS05860 (gbs1095) | 1141537..1142736 | - | 1200 | WP_001067079 | NADH-dependent flavin oxidoreductase | - |
| GBS_RS05865 (gbs1096) | 1142729..1143565 | - | 837 | WP_000455156 | lipoate--protein ligase family protein | - |
| GBS_RS05870 (gbs1097) | 1143719..1144405 | + | 687 | WP_011074729 | phosphopantothenate--cysteine ligase | - |
| GBS_RS05875 (gbs1098) | 1144398..1144940 | + | 543 | WP_000595814 | phosphopantothenoylcysteine decarboxylase | - |
| GBS_RS05880 (gbs1099) | 1144986..1145558 | + | 573 | WP_000728784 | ECF transporter S component | - |
| GBS_RS05885 (gbs1100) | 1145668..1147386 | + | 1719 | WP_000222544 | phospho-sugar mutase | - |
| GBS_RS05890 | 1147450..1147647 | - | 198 | WP_000746859 | hypothetical protein | - |
| GBS_RS05895 (gbs1102) | 1147661..1149394 | - | 1734 | WP_000647638 | ABC transporter ATP-binding protein | - |
| GBS_RS05900 (gbs1103) | 1149395..1151116 | - | 1722 | WP_000826946 | ABC transporter ATP-binding protein | - |
| GBS_RS05905 (gbs1104) | 1151128..1151730 | - | 603 | WP_000472259 | lysozyme family protein | - |
| GBS_RS05910 (gbs1105) | 1151732..1152709 | - | 978 | WP_000968655 | nucleoid-associated protein | - |
| GBS_RS05915 (gbs1106) | 1152714..1153970 | - | 1257 | WP_000575545 | serine hydroxymethyltransferase | - |
| GBS_RS05920 (gbs1107) | 1154062..1154658 | - | 597 | WP_000998735 | L-threonylcarbamoyladenylate synthase | - |
| GBS_RS05925 (gbs1108) | 1154651..1155481 | - | 831 | WP_001104948 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| GBS_RS05930 (gbs1109) | 1155481..1156560 | - | 1080 | WP_001028826 | peptide chain release factor 1 | - |
| GBS_RS05935 (gbs1110) | 1156595..1157164 | - | 570 | WP_000068109 | thymidine kinase | - |
| GBS_RS05940 (gbs1111) | 1157302..1157484 | + | 183 | WP_001117229 | 4-oxalocrotonate tautomerase | - |
| GBS_RS05945 (gbs1112) | 1157633..1158571 | + | 939 | WP_001177176 | FAD:protein FMN transferase | - |
| GBS_RS05950 (gbs1113) | 1158589..1159191 | + | 603 | WP_000766628 | NADPH-dependent FMN reductase | - |
| GBS_RS05955 (gbs1114) | 1159215..1160450 | + | 1236 | WP_000673645 | NAD(P)H-dependent oxidoreductase | - |
| GBS_RS05960 (gbs1115) | 1160549..1161337 | + | 789 | WP_000051848 | formate/nitrite transporter family protein | - |
| GBS_RS05965 (gbs1116) | 1161436..1162710 | - | 1275 | WP_000671140 | nucleobase:cation symporter-2 family protein | - |
| GBS_RS05970 (gbs1117) | 1162710..1163291 | - | 582 | WP_000770389 | xanthine phosphoribosyltransferase | - |
| GBS_RS05975 (gbs1118) | 1163887..1165149 | - | 1263 | WP_000090507 | ISLre2 family transposase | - |
| GBS_RS05980 (gbs1119) | 1165322..1165621 | - | 300 | WP_001262471 | hypothetical protein | - |
| GBS_RS05985 (gbs1120) | 1165632..1166879 | - | 1248 | WP_000764234 | site-specific DNA-methyltransferase | - |
| GBS_RS05990 (gbs1121) | 1166876..1168507 | - | 1632 | WP_000261836 | relaxase/mobilization nuclease domain-containing protein | - |
| GBS_RS05995 (gbs1122) | 1168479..1168853 | - | 375 | WP_000436063 | plasmid mobilization relaxosome protein MobC | - |
| GBS_RS06000 (gbs1123) | 1168856..1169419 | - | 564 | WP_000988935 | hypothetical protein | - |
| GBS_RS06005 (gbs1125) | 1169762..1170061 | - | 300 | WP_000627207 | hypothetical protein | - |
| GBS_RS06010 (gbs1126) | 1170113..1173349 | - | 3237 | WP_000024354 | PBECR4 domain-containing protein | - |
| GBS_RS06015 (gbs1127) | 1173351..1173716 | - | 366 | WP_000188894 | hypothetical protein | - |
| GBS_RS06020 (gbs1128) | 1173758..1175803 | - | 2046 | WP_000421159 | VirD4-like conjugal transfer protein, CD1115 family | - |
| GBS_RS06025 (gbs1129) | 1175803..1176294 | - | 492 | WP_000371901 | DUF3801 domain-containing protein | cd411 |
| GBS_RS06030 (gbs1130) | 1176316..1177098 | - | 783 | WP_000488485 | hypothetical protein | - |
| GBS_RS06035 (gbs1131) | 1177098..1177370 | - | 273 | WP_000606554 | hypothetical protein | - |
| GBS_RS06040 (gbs1132) | 1177390..1177995 | - | 606 | WP_000567358 | hypothetical protein | prgL |
| GBS_RS06045 (gbs1133) | 1178016..1180706 | - | 2691 | WP_000134095 | phage tail tip lysozyme | prgK |
| GBS_RS06050 | 1181249..1181458 | - | 210 | WP_000745034 | hypothetical protein | - |
| GBS_RS06055 (gbs1135) | 1181463..1183814 | - | 2352 | WP_000176428 | VirB4-like conjugal transfer ATPase, CD1110 family | virb4 |
| GBS_RS06060 (gbs1136) | 1183795..1184154 | - | 360 | WP_001037292 | PrgI family protein | - |
| GBS_RS06065 (gbs1137) | 1184216..1184674 | - | 459 | WP_000609828 | hypothetical protein | - |
| GBS_RS06070 (gbs1138) | 1184735..1184962 | - | 228 | WP_000362731 | hypothetical protein | - |
| GBS_RS06075 (gbs1139) | 1185206..1185703 | - | 498 | WP_000040950 | hypothetical protein | - |
| GBS_RS06080 (gbs1140) | 1185717..1186469 | - | 753 | WP_000651825 | membrane protein | prgHb |
| GBS_RS06085 (gbs1141) | 1186518..1187003 | - | 486 | WP_000004254 | hypothetical protein | - |
| GBS_RS06090 (gbs1142) | 1187109..1187336 | - | 228 | WP_000447008 | hypothetical protein | prgF |
| GBS_RS06095 (gbs1143) | 1187611..1190409 | - | 2799 | WP_001088030 | SspB-related isopeptide-forming adhesin | prgB |
| GBS_RS06100 (gbs1144) | 1190476..1191186 | - | 711 | WP_001042360 | LPXTG cell wall anchor domain-containing protein | prgC |
| GBS_RS06105 (gbs1145) | 1191201..1193432 | - | 2232 | WP_001071823 | LPXTG cell wall anchor domain-containing protein | - |
| GBS_RS06110 (gbs1146) | 1193449..1193748 | - | 300 | WP_000129105 | hypothetical protein | - |
| GBS_RS06115 (gbs1147) | 1194131..1194328 | - | 198 | WP_000208122 | helix-turn-helix transcriptional regulator | - |
| GBS_RS06120 (gbs1148) | 1194325..1194510 | - | 186 | WP_000938679 | hypothetical protein | - |
| GBS_RS06125 (gbs1149) | 1194512..1195537 | - | 1026 | WP_000822468 | replication initiator protein A | - |
| GBS_RS11725 | 1195539..1195703 | - | 165 | WP_000166480 | hypothetical protein | - |
Host bacterium
| ID | 100 | Element type | ICE (Integrative and conjugative element) |
| Element name | TnGBS1 | GenBank | NC_004368 |
| Element size | 2211485 bp | Coordinate of oriT [Strand] | 395366..395420 [+] |
| Host bacterium | Streptococcus agalactiae NEM316 | Coordinate of element | 385757..432824 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | AcrIIA7, AcrIIA21 |