Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   200079
Name   oriT_MGIVchHai6 experimental
Organism   Vibrio cholerae HC-36A1
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   AXDR01000001 (_)
oriT length   49 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   49 bp minimal oriT

  oriT sequence  


Download         Length: 49 nt

>oriT_MGIVchHai6
TCCAAGATCCCCCATCAGATAGTTATTGGAAAGGAATTGGTAGGGTCTT

Visualization of oriT structure (The oriT was characterized experimentally)

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Rivard N et al. (2020) Antibiotic Resistance in Vibrio cholerae: Mechanistic Insights from IncC Plasmid-Mediated Dissemination of a Novel Family of Genomic Islands Inserted at trmE. mSphere. 5(4):e00748-20. [PMID:32848007]
[2] Carraro N et al. (2016) IncA/C Conjugative Plasmids Mobilize a New Family of Multidrug Resistance Islands in Clinical Vibrio cholerae Non-O1/Non-O139 Isolates from Haiti. mBio. 7(4):e00509-16. [PMID:27435459]


Relaxase

ID   1068 GenBank   ERP70969
Name   MobI_MGIVchHai6 insolico UniProt ID   _
Length   264 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 264 a.a.        Molecular weight: 31080.19 Da        Isoelectric Point: 9.3116

>ERP70969.1 hypothetical protein VCHC36A1_0084 [Vibrio cholerae HC-36A1]
MAKASQQKTRVPQKGTKAGDELTHETIDSLCIQHTVDYVMTKNYSFLEQQIVAFGAALNRGNQPQSEYIE
AFSKSFKGLETQINIWETFIANSTNVNQDDAMLFSLSVSEQYLRYTHKSIEIEQIRYYYIAQKIADLFWQ
HNREHRGKNSPGYPGHFGCRVRLRNKKLEIFWVYNQFKPKKNSDGFQVISHYLPRDGHFRYPKTTFTRAQ
DWEKPVIEVVEDAFAIIRRTNANLMRIRQLCRWNNDNLYKMAGEIDDFKMDNPL

  Protein domains


Predicted by InterproScan.

MobI protein (MobI)

(129-241)


  Protein structure



No available structure.



  Reference


[1] Rivard N et al. (2020) Antibiotic Resistance in Vibrio cholerae: Mechanistic Insights from IncC Plasmid-Mediated Dissemination of a Novel Family of Genomic Islands Inserted at trmE. mSphere. 5(4):e00748-20. [PMID:32848007]


Host bacterium

ID   87 Element type   IME (Integrative mobilizable element)
Element name   MGIVchHai6 GenBank   AXDR01000001
Element size   145591 bp Coordinate of oriT [Strand]   85939..85988 [-]
Host bacterium   Vibrio cholerae HC-36A1 Coordinate of element   43098..91582

Cargo genes

Drug resistance gene   aadA2, qacE, sul1, dfrA23, floR, tet(G), blaCARB-2
Virulence gene   Virulence genes: RhuM
Metal resistance gene   merP, merA, merR2
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -