Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   200055
Name   oriT_Tn6087 in_silico
Organism   Streptococcus oralis strain F.MI.5
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   HQ663849 (2441..2655 [+], 215 nt)
oriT length   215 nt
IRs (inverted repeats)      61..76, 80..95  (ACTTAACCCCCCGTAT..ACAGGGGGGTACAAAT)
  123..134, 139..150  (GAAAATCCTTTG..CAAGGGATTTAC)
Location of nic site      135..136
Conserved sequence flanking the
  nic site    		  TGG|T
Note   blastn alignment with the oriT_Tn916

  oriT sequence  


Download         Length: 215 nt

>oriT_Tn6087
AAGCGGAAGTCGCAGGTGTGGACTGATCTTGCTGGCTGGTGTGGCAATAGCCACGCCAGCACTTAACCCCCCGTATCTAACAGGGGGGTACAAATCGACAGGAAACAGTCAAAAAAACATTAGAAAATCCTTTGGTTACAAGGGATTTACAAAATTTCAGCGTTTGTCAAATGGGCTTTAAAAGTTGACATACGCCTTTTTGATTGGAGGGATTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   269 GenBank   ADV76295
Name   ORF21_Tn6087 insolico UniProt ID   E9NM67
Length   461 a.a. PDB ID   _
Note   FtsK/SpoIIIE family protein; Tn916-like ORF21

  T4CP protein sequence


Download         Length: 461 a.a.        Molecular weight: 53357.23 Da        Isoelectric Point: 8.9454

>ADV76295.1 hypothetical protein [Streptococcus oralis]
MKQRGKRIRPSGKDLVFHFTIASLLPVFLLVVGLFHVKTIQQINWQDFNLSQADKIDIPYLIISFSVAIL
ICLLVAFVFKRVRYDTVKQLYHRQKLAKMILENKWYESEQVKTEGFFKDSAGRTKEKITYFPKMYYRLKN
GLIQIRVEITLGKYQDQLLHLEKKLESGLYCELTDKELKDSYVEYTLLYDTIASRISIDEVEAKDGKLRL
MKNVWWEYDKLPHMLIAGGTGGGKTYFILTLIEALLHTDSKLYILDPKNADLADLGSVMANVYYRKEDLL
SCIETFYEEMMKRSEEMKQMKNYKTGKNYAYLGLPAHFLIFDEYVAFMEMLGTKENTAVMNKLKQIVMLG
RQAGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGSDVQKDFFLKRIKGRGYVDVGTSV
ISEFYTPLVPKGYDFLEEVKKLSDSRQSTQATCEAEVAGVD

  Protein domains


Predicted by InterproScan.

FtsK/SpoIIIE family (FtsK_SpoIIIE)

(217-301)

  Protein structure


Source ID Structure
AlphaFold DB E9NM67


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 336..14883

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
Locus_0 194..265 + 72 ADV76292 hypothetical protein -
Locus_1 336..650 + 315 ADV76293 hypothetical protein orf23
Locus_2 666..1052 + 387 ADV76294 hypothetical protein orf23
Locus_3 1081..2466 + 1386 ADV76295 hypothetical protein virb4
Locus_4 3892..4113 + 222 ADV76296 hypothetical protein orf19
Locus_5 4230..4727 + 498 ADV76297 hypothetical protein -
Locus_6 4702..5208 + 507 ADV76298 hypothetical protein orf17a
Locus_7 5192..5620 + 429 ADV76299 hypothetical protein -
Locus_8 9158..9844 - 687 ADV76300 hypothetical protein -
Locus_9 10358..10684 - 327 ADV76301 small multidrug resistance protein -
Locus_10 10950..11255 + 306 ADV76302 hypothetical protein -
Locus_11 11475..12161 - 687 ADV76303 hypothetical protein -
Locus_12 12950..13951 + 1002 ADV76304 hypothetical protein orf14
Locus_13 13948..14883 + 936 ADV76305 hypothetical protein orf13
Locus_14 15158..15244 + 87 ADV76306 hypothetical protein -
Locus_15 15260..17179 + 1920 ADV76307 TetM -
Locus_16 17277..17465 + 189 ADV76308 hypothetical protein -
Locus_17 17525..17878 - 354 ADV76309 hypothetical protein -
Locus_18 18083..18154 + 72 ADV76310 hypothetical protein -
Locus_19 18332..18805 + 474 ADV76311 hypothetical protein -
Locus_20 18802..19032 + 231 ADV76312 hypothetical protein -
Locus_21 19258..19509 - 252 ADV76313 hypothetical protein -
Locus_22 19493..19696 + 204 ADV76314 hypothetical protein -

Host bacterium

ID   60 Element type   Transposon
Element name   Tn6087 GenBank   HQ663849
Element size   21169 bp Coordinate of oriT [Strand]   2441..2655 [+]
Host bacterium   Streptococcus oralis strain F.MI.5

Cargo genes

Drug resistance gene   tet(M)
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -