Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   200054
Name   oriT_Tn916(RST11) in_silico
Organism   Staphylococcus rostri
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   FN550102 (2441..2655 [+], 215 nt)
oriT length   215 nt
IRs (inverted repeats)      61..76, 80..95  (ACTTAACCCCCCGTAT..ACAGGGGGGTACAAAT)
  123..134, 139..150  (GAAAATCCTTTG..CAAGGGATTTAC)
Location of nic site      135..136
Conserved sequence flanking the
  nic site  
 
 TGG|T
Note   blastn alignment with the oriT_Tn916

  oriT sequence  


Download         Length: 215 nt

>oriT_Tn916(RST11)
AAGCGGAAGTCGCAGGTGTGGACTGATCTTGCTGGCTGGTGTGGCAATAGCCACGCCAGCACTTAACCCCCCGTATCTAACAGGGGGGTACAAATCGACAGGAAACAGTCAAAAAAACATTAGAAAATCCTTTGGTTACAAGGGATTTACAAAATTTCAGCGTATGTCAAATGGGCTTTAAAAGTTGACATACGCCTTTTTGATTGGAGGGATTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   268 GenBank   CBE66529
Name   ORF20_Tn916(RST11) insolico UniProt ID   C8ZL35
Length   329 a.a. PDB ID   
Note   putative transcriptional regulator

  Relaxase protein sequence


Download         Length: 329 a.a.        Molecular weight: 39099.72 Da        Isoelectric Point: 7.0754

>CBE66529.1 putative transcriptional regulator [Staphylococcus rostri]
MLFDYVRIRFPTTDVQQVVENILQLKLSYFLHEDYGFYSYSEHYALGDIFVLCSHELDKGVLVELKGRGC
RQFESYLLAQQRSWYEFFMDVLVAGGVMKRLDLAINDKTGILNIPVLTEKCQQEECISVFRSFKSYRSGE
LVRKEEKECMGNTLYIGSLQSEVYFCIYEKDYEQYKKNDIPIEDAEVKNRFEIRLKNERAYYAVRDLLVY
DNPEHTAFKIINRYIRFVDKDDSKPRSDWKLNEEWAWFIGNNRERLKLTTKPEPYSFQRTLNWLSHQVAP
TLKVAIKLDEINQTQVVKDILDHAKLTDRHKQILKQQSVKEQDVITTKK

  Protein domains


Predicted by InterproScan.

(2-89)

(97-301)


  Protein structure


Source ID Structure
AlphaFold DB C8ZL35


T4CP


ID   268 GenBank   CBE66528
Name   ORF21_Tn916(RST11) insolico UniProt ID   C8ZL34
Length   461 a.a. PDB ID   _
Note   _

  T4CP protein sequence


Download         Length: 461 a.a.        Molecular weight: 53370.27 Da        Isoelectric Point: 9.0687

>CBE66528.1 hypothetical protein [Staphylococcus rostri]
MKQRGKRIRPSGKDLVFHFTIASLLPVFLLVVGLFHVKTIQQINWQDFNLSQADKIDIPYLIISFSVAIL
ICLLVAFVFKRVRYDTVKQLYHRQKLAKMILENKWYESEQVKTEGFFKDSAGRTKEKITYFPKMYYRLKN
GLIQIRVEITLGKYQDQLLHLEKKLESGLYCELTDKELKDSYVEYTLLYDTIASRISIDEVEAKDGKLRL
MKNVWWEYDKLPHMLIAGGTGGGKTYFILTLIEALLHTDSKLYILDPKNADLADLGSVMANVYYRKEDLL
SCIETFYEEMMKRSEEMKQMKNYKTGKNYAYLGLPAHFLIFDEYVAFMEMLGTKENTAVMNKLKQIVMLG
RQAGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGSDVQKDFFLKRIKGRGYVDVGTSV
ISEFYTPLVPKGYDFLEEIKKLSNSRQSTQATCEAEVAGVD

  Protein domains


Predicted by InterproScan.

(217-301)

  Protein structure


Source ID Structure
AlphaFold DB C8ZL34


T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 336..11746

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
Locus_0 194..313 + 120 CBE66525 hypothetical protein -
Locus_1 336..650 + 315 CBE66526 conjugative transposon protein orf23
Locus_2 666..1052 + 387 CBE66527 conjugative transposon protein orf23
Locus_3 1081..2466 + 1386 CBE66528 hypothetical protein virb4
Locus_4 2860..3849 + 990 CBE66529 putative transcriptional regulator -
Locus_5 3892..4113 + 222 CBE66530 conjugative transposon protein orf19
Locus_6 4230..4727 + 498 CBE66531 conjugative transposon protein -
Locus_7 4702..5208 + 507 CBE66532 conjugative transposon protein orf17a
Locus_8 5192..7639 + 2448 CBE66533 putative regulatory protein virb4
Locus_9 7642..9819 + 2178 CBE66534 putative membrane protein orf15
Locus_10 9816..10817 + 1002 CBE66535 putative membrane protein orf14
Locus_11 10814..11746 + 933 CBE66536 putative membrane protein orf13
Locus_12 12021..12107 + 87 CBE66537 tetM leader peptide -
Locus_13 12108..14042 + 1935 CBE66538 tetracycline resistance protein -
Locus_14 14140..14328 + 189 CBE66539 putative transcriptional regulator -
Locus_15 14388..14741 + 354 Protein_15 - -
Locus_16 14946..15017 + 72 CBE66541 putative ATP-binding protein -
Locus_17 15195..15668 + 474 CBE66542 putative regulatory protein -
Locus_18 15665..15895 + 231 CBE66543 putative ATP-binding protein -
Locus_19 16121..16372 - 252 CBE66544 excisionase -
Locus_20 16356..16559 + 204 CBE66545 excisionase -


Host bacterium


ID   59 Element type   Transposon
Element name   Tn916(RST11) GenBank   FN550102
Element size   18032 bp Coordinate of oriT [Strand]   2441..2655 [+]
Host bacterium   Staphylococcus rostri

Cargo genes


Drug resistance gene   tet(M)
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -