Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   200053
Name   oriT_ICESpnH19A6-1 in_silico
Organism   Streptococcus pneumoniae Hungary19A-6
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   CP000936 (1320264..1320478 [-], 215 nt)
oriT length   215 nt
IRs (inverted repeats)      61..76, 80..95  (ACTTAACCCCCCGTAT..ACAGGGGGGTACAAAT)
  123..134, 139..150  (GAAAATCCTTTG..CAAGGGATTTAC)
Location of nic site      135..136
Conserved sequence flanking the
  nic site  
 
 TGG|T
Note   blastn alignment with the oriT_Tn916

  oriT sequence  


Download         Length: 215 nt

>oriT_ICESpnH19A6-1
AAGCGGAAGTCGCAGGTGTGGACTGATCTTGCTGGCTGGTGTGGCAATAGCCACGCCAGCACTTAACCCCCCGTATCTAACAGGGGGGTACAAATCGACAGGAAACAGTCAAAAAAACATTAGAAAATCCTTTGGTTACAAGGGATTTACAAAATTTCAGCGTATGTCAAATGGGCTTTAAAAGTTGACATACGCCTTTTTGATTGGAGGGATTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   267 GenBank   ACA37101
Name   Relaxase_ICESpnH19A6-1 insolico UniProt ID   B1IC95
Length   409 a.a. PDB ID   
Note   transcriptional regulator, Cro/CI family

  Relaxase protein sequence


Download         Length: 409 a.a.        Molecular weight: 48250.06 Da        Isoelectric Point: 6.5921

>ACA37101.1 transcriptional regulator, Cro/CI family [Streptococcus pneumoniae Hungary19A-6]
MEGFLLNEQTWLQHLKEKRLAYGLSQNRLAVATGITRQYLSDIETGKVKPSEDLQQSLWEALERFNPDAP
LEMLFDYVRIRFPTTDVQQVVENILQLKLSYFLHEDYGFYSYSEHYALGDIFVLCSHELDKGVLVELKGR
GCRQFESYLLAQQRSWYEFFMDVLVAGGVMKLLDLAINDKTGILNIPVLTEKCQQEECISVFRSFKSYRS
GELVRKEEKECMGNTLYIGSLQSEVYFCIYEKDYEQYKKNDIPIEDAEVKNRFEIRLKNERAYYAVRDLL
VYDNPEHTAFKIINRYIRFVDKDDSKPRSDWKLNEEWAWFIGNNRERLKLTTKPEPYSFQRTLNWLSHQV
APTLKVAIKLDEINQTQVVKDILDHAKLTDRHKQILKQQSVKEQDVITTKKRISVNHTS

  Protein domains


Predicted by InterproScan.

(15-53)

(73-161)

(170-373)


  Protein structure


Source ID Structure
AlphaFold DB B1IC95


T4CP


ID   267 GenBank   ACA36356
Name   T4CP_ICESpnH19A6-1 insolico UniProt ID   B1IC96
Length   461 a.a. PDB ID   _
Note   ftsk/spoiiie family protein

  T4CP protein sequence


Download         Length: 461 a.a.        Molecular weight: 53370.27 Da        Isoelectric Point: 9.0687

>ACA36356.1 ftsk/spoiiie family protein [Streptococcus pneumoniae Hungary19A-6]
MKQRGKRIRPSGKDLVFHFTIASLLPVFLLVVGLFHVKTIQQINWQDFNLSQADKIDIPYLIISFSVAIL
ICLLVAFVFKRVRYDTVKQLYHRQKLAKMILENKWYESEQVKTEGFFKDSAGRTKEKITYFPKMYYRLKN
GLIQIRVEITLGKYQDQLLHLEKKLESGLYCELTDKELKDSYVEYTLLYDTIASRISIDEVEAKDGKLRL
MKNVWWEYDKLPHMLIAGGTGGGKTYFILTLIEALLHTDSKLYILDPKNADLADLGSVMANVYYRKEDLL
SCIETFYEEMMKRSEEMKQMKNYKTGKNYAYLGLPAHFLIFDEYVAFMEMLGTKENTAVMNKLKQIVMLG
RQAGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGSDVQKDFFLKRIKGRGYVDVGTSV
ISEFYTPLVPKGYDFLEEIKKLSNSRQSTQATCEAEVAGVD

  Protein domains


Predicted by InterproScan.

(217-301)

  Protein structure


Source ID Structure
AlphaFold DB B1IC96


T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 1308321..1322583

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SPH_1403 1303508..1303711 - 204 ACA37419 conserved domain protein -
SPH_1404 1303695..1303946 + 252 ACA35758 conserved hypothetical protein -
SPH_1405 1304172..1304402 - 231 ACA36408 conserved hypothetical protein -
SPH_1406 1304399..1304821 - 423 ACA35641 sigma-70, region 4 family -
SPH_1407 1305050..1305196 - 147 ACA36714 conserved hypothetical protein -
SPH_1408 1305326..1305679 + 354 ACA37224 transcriptional regulator, putative -
SPH_1409 1306025..1307944 - 1920 ACA37605 tetracycline resistance protein -
SPH_1410 1307960..1308076 - 117 ACA37321 Tetracycline resistance determinant leader peptide -
SPH_1411 1308321..1309238 - 918 ACA37003 conjugative transposon protein orf13
SPH_1412 1309253..1310254 - 1002 ACA36364 NLP/P60 family protein orf14
SPH_1413 1310251..1312428 - 2178 ACA35787 conjugative transposon membrane protein orf15
SPH_1414 1312431..1314878 - 2448 ACA37348 conjugative transposon protein virb4
SPH_1415 1314862..1315368 - 507 ACA36762 conjugative transposon membrane protein orf17a
SPH_1416 1315343..1315840 - 498 ACA37337 conjugative transposon protein -
SPH_1417 1315957..1316178 - 222 ACA36148 conserved domain protein orf19
SPH_1418 1316358..1317605 + 1248 ACA37581 transposase -
SPH_1419 1317726..1317917 - 192 ACA36129 conserved hypothetical protein -
SPH_1420 1317862..1318599 - 738 ACA36985 rRNA adenine N-6-methyltransferase (Macrolide-lincosamide-streptogramin B resistance protein) -
SPH_1422 1319046..1320275 - 1230 ACA37101 transcriptional regulator, Cro/CI family -
SPH_1423 1320453..1321838 - 1386 ACA36356 ftsk/spoiiie family protein virb4
SPH_1424 1321867..1322250 - 384 ACA35852 conjugative transposon protein orf23
SPH_1425 1322269..1322583 - 315 ACA37134 conjugative transposon protein orf23
SPH_1426 1322606..1322725 - 120 ACA36774 conserved hypothetical protein -
SPH_1427 1323215..1324498 + 1284 ACA36826 uracil permease -
SPH_1428 1324594..1326165 - 1572 ACA35896 signal recognition particle protein -
SPH_1429 1326177..1326509 - 333 ACA37645 putative helix-turn-helix protein -
SPH_1430 1326600..1326977 - 378 ACA35656 conserved hypothetical protein -


Host bacterium


ID   58 Element type   Transposon
Element name   ICESpnH19A6-1 GenBank   CP000936
Element size   2245615 bp Coordinate of oriT [Strand]   1320264..1320478 [-]
Host bacterium   Streptococcus pneumoniae Hungary19A-6 Coordinate of element   1302035..1322918

Cargo genes


Drug resistance gene   tet(M), erm(B)
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -