Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   200045
Name   oriT_ICESpnTw19F14-1 in_silico
Organism   Streptococcus pneumoniae Taiwan19F-14
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   CP000921 (1787601..1787815 [+], 215 nt)
oriT length   215 nt
IRs (inverted repeats)      61..76, 80..95  (ACTTAACCCCCCGTAT..ACAGGGGGGTACAAAT)
  123..134, 139..150  (GAAAATCCTTTG..CAAGGGATTTAC)
Location of nic site      135..136
Conserved sequence flanking the
  nic site  
 
 TGG|T
Note   blastn alignment with the oriT_Tn916

  oriT sequence  


Download         Length: 215 nt

>oriT_ICESpnTw19F14-1
AAGCGGAAGTCGCAGGTGTGGACTGATCTTGCTGGCTGGTGTGGCAATAGCCACGCCAGCACTTAACCCCCCGTATCTAACAGGGGGGTACAAATCGACAGGAAACAGTCAAAAAAACATTAGAAAATCCTTTGGTTACAAGGGATTTACAAAATTTCAGCGTATGTCAAATGGGCTTTAAAAGTTGACATACGCCTTTTTGATTGGAGGGATTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   259 GenBank   ACO22579
Name   Relaxase_ICESpnTw19F14-1 insolico UniProt ID   _
Length   401 a.a. PDB ID   
Note   transcriptional regulator, Cro/CI family

  Relaxase protein sequence


Download         Length: 401 a.a.        Molecular weight: 47398.10 Da        Isoelectric Point: 6.5091

>ACO22579.1 transcriptional regulator, Cro/CI family [Streptococcus pneumoniae Taiwan19F-14]
MEGFLLNEQTWLQHLKEKRLAYGLSQNRLAVATGITRQYLSDIETGKVKPSEDLQQSLWEALERFNPDAP
LEMLFDYVRIRFPTTDVQQVVENILQLKLSYFLHEDYGFYSYSEHYALGDIFVLCSHELDKGVLVELKGR
GCRQFESYLLAQQRSWYEFFMDVLVAGGVMKRLDLAINDKTGILNIPVLTEKCQQEECISVFRSFKSYRS
GELVRKEEKECMGNTLYIGSLQSEVYFCIYEKDYEQYKKNDIPIEDAEVKNRFEIRLKNERAYYAVRDLL
VYDNPEHTAFKIINRYIRFVDKDDSKPRSDWKLNEEWAWFIGNNRERLKLTTKPEPYSFQRTLNWLSHQV
APTLKVAIKLDEINQTQVVKDILDHAKLTDRHKQILKQQSVKEQDVITTKK

  Protein domains


Predicted by InterproScan.

(15-53)

(169-373)

(73-161)


  Protein structure



No available structure.




T4CP


ID   259 GenBank   ACO23578
Name   T4CP_ICESpnTw19F14-1 insolico UniProt ID   _
Length   461 a.a. PDB ID   _
Note   ftsk/spoiiie family protein

  T4CP protein sequence


Download         Length: 461 a.a.        Molecular weight: 53370.27 Da        Isoelectric Point: 9.0687

>ACO23578.1 ftsk/spoiiie family protein [Streptococcus pneumoniae Taiwan19F-14]
MKQRGKRIRPSGKDLVFHFTIASLLPVFLLVVGLFHVKTIQQINWQDFNLSQADKIDIPYLIISFSVAIL
ICLLVAFVFKRVRYDTVKQLYHRQKLAKMILENKWYESEQVKTEGFFKDSAGRTKEKITYFPKMYYRLKN
GLIQIRVEITLGKYQDQLLHLEKKLESGLYCELTDKELKDSYVEYTLLYDTIASRISIDEVEAKDGKLRL
MKNVWWEYDKLPHMLIAGGTGGGKTYFILTLIEALLHTDSKLYILDPKNADLADLGSVMANVYYRKEDLL
SCIETFYEEMMKRSEEMKQMKNYKTGKNYAYLGLPAHFLIFDEYVAFMEMLGTKENTAVMNKLKQIVMLG
RQAGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGSDVQKDFFLKRIKGRGYVDVGTSV
ISEFYTPLVPKGYDFLEEIKKLSNSRQSTQATCEAEVAGVD

  Protein domains


Predicted by InterproScan.

(217-301)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 1785496..1796906

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SPT_1900 1780883..1781899 - 1017 ACO22516 regulator of lytrabc operon -
SPT_1901 1781907..1782425 - 519 ACO22979 acetyltransferase, gnat family -
SPT_1902 1782415..1782858 - 444 ACO23444 conserved hypothetical protein -
SPT_1903 1782944..1783564 - 621 ACO23895 lipoprotein, putative -
SPT_1904 1783870..1784733 - 864 ACO22280 transcriptional activator -
SPT_1905 1784924..1785094 + 171 ACO23716 conserved hypothetical protein -
SPT_1906 1785354..1785473 + 120 ACO23093 hypothetical protein -
SPT_1907 1785496..1785810 + 315 ACO22681 conjugative transposon protein orf23
SPT_1908 1785829..1786212 + 384 ACO24063 conjugative transposon protein orf23
SPT_1909 1786241..1787626 + 1386 ACO23578 ftsk/spoiiie family protein virb4
SPT_1910 1787804..1789009 + 1206 ACO22579 transcriptional regulator, Cro/CI family -
SPT_1911 1789052..1789273 + 222 ACO23012 conserved domain protein orf19
SPT_1912 1789390..1789887 + 498 ACO22545 conjugative transposon protein -
SPT_1913 1789862..1790368 + 507 ACO24205 conjugative transposon membrane protein orf17a
SPT_1914 1790352..1792799 + 2448 ACO23752 conjugative transposon protein virb4
SPT_1915 1792802..1794979 + 2178 ACO22770 conjugative transposon membrane protein orf15
SPT_1916 1794976..1795977 + 1002 ACO22322 NLP/P60 family protein orf14
SPT_1917 1795974..1796906 + 933 ACO22536 conjugative transposon protein orf13
SPT_1918 1797181..1797267 + 87 ACO22508 tetracycline resistance determinant leader peptide -
SPT_1919 1797283..1799202 + 1920 ACO23503 tetracycline resistance protein -
SPT_1922 1799808..1800143 + 336 ACO23145 conserved hypothetical protein -
SPT_1923 1800213..1800524 + 312 ACO23868 conserved hypothetical protein -
SPT_1924 1800511..1800810 + 300 ACO22241 conserved hypothetical protein -


Host bacterium


ID   50 Element type   Transposon
Element name   ICESpnTw19F14-1 GenBank   CP000921
Element size   2112148 bp Coordinate of oriT [Strand]   1787601..1787815 [+]
Host bacterium   Streptococcus pneumoniae Taiwan19F-14 Coordinate of element   1785161..1808701

Cargo genes


Drug resistance gene   tet(M), msr(D), mef(A)
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -