Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   200042
Name   oriT_ICESpnCGSP14-1 in_silico
Organism   Streptococcus pneumoniae CGSP14
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   CP001033 (162035..162249 [+], 215 nt)
oriT length   215 nt
IRs (inverted repeats)      61..76, 80..95  (ACTTAACCCCCCGTAT..ACAGGGGGGTACAAAT)
  123..134, 139..150  (GAAAATCCTTTG..CAAGGGATTTAC)
Location of nic site      135..136
Conserved sequence flanking the
  nic site    		  TGG|T
Note   blastn alignment with the oriT_Tn916

  oriT sequence  


Download         Length: 215 nt

>oriT_ICESpnCGSP14-1
AAGCGGAAGTCGCAGGTGTGGACTGATCTTGCTGGCTGGTGTGGCAATAGCCACGCCAGCACTTAACCCCCCGTATCTAACAGGGGGGTACAAATCGACAGGAAACAGTCAAAAAAACATTAGAAAATCCTTTGGTTACAAGGGATTTACAAAATTTCAGCGTATGTCAAATGGGCTTTAAAAGTTGACATACGCCTTTTTGATTGGAGGGATTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   256 GenBank   ACB89414
Name   Relaxase_ICESpnCGSP14-1 insolico UniProt ID   B2IRY4
Length   401 a.a. PDB ID   
Note   Tn916, transcriptional regulator, putative

  Relaxase protein sequence


Download         Length: 401 a.a.        Molecular weight: 47398.10 Da        Isoelectric Point: 6.5091

>ACB89414.1 Tn916, transcriptional regulator, putative [Streptococcus pneumoniae CGSP14]
MEGFLLNEQTWLQHLKEKRLAYGLSQNRLAVATGITRQYLSDIETGKVKPSEDLQQSLWEALERFNPDAP
LEMLFDYVRIRFPTTDVQQVVENILQLKLSYFLHEDYGFYSYSEHYALGDIFVLCSHELDKGVLVELKGR
GCRQFESYLLAQQRSWYEFFMDVLVAGGVMKRLDLAINDKTGILNIPVLTEKCQQEECISVFRSFKSYRS
GELVRKEEKECMGNTLYIGSLQSEVYFCIYEKDYEQYKKNDIPIEDAEVKNRFEIRLKNERAYYAVRDLL
VYDNPEHTAFKIINRYIRFVDKDDSKPRSDWKLNEEWAWFIGNNRERLKLTTKPEPYSFQRTLNWLSHQV
APTLKVAIKLDEINQTQVVKDILDHAKLTDRHKQILKQQSVKEQDVITTKK

  Protein domains


Predicted by InterproScan.

Helix-turn-helix (HTH_3)

(15-53)

Replication initiation factor (Rep_trans)

(169-373)

Rolling Circle replication initiation protein N-terminal domain (Rol_Rep_N)

(73-161)


  Protein structure


Source ID Structure
AlphaFold DB B2IRY4


T4CP

ID   256 GenBank   ACB89413
Name   T4CP_ICESpnCGSP14-1 insolico UniProt ID   B2IQE9
Length   461 a.a. PDB ID   _
Note   _

  T4CP protein sequence


Download         Length: 461 a.a.        Molecular weight: 53370.27 Da        Isoelectric Point: 9.0687

>ACB89413.1 hypothetical protein SPCG_0161 [Streptococcus pneumoniae CGSP14]
MKQRGKRIRPSGKDLVFHFTIASLLPVFLLVVGLFHVKTIQQINWQDFNLSQADKIDIPYLIISFSVAIL
ICLLVAFVFKRVRYDTVKQLYHRQKLAKMILENKWYESEQVKTEGFFKDSAGRTKEKITYFPKMYYRLKN
GLIQIRVEITLGKYQDQLLHLEKKLESGLYCELTDKELKDSYVEYTLLYDTIASRISIDEVEAKDGKLRL
MKNVWWEYDKLPHMLIAGGTGGGKTYFILTLIEALLHTDSKLYILDPKNADLADLGSVMANVYYRKEDLL
SCIETFYEEMMKRSEEMKQMKNYKTGKNYAYLGLPAHFLIFDEYVAFMEMLGTKENTAVMNKLKQIVMLG
RQAGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGSDVQKDFFLKRIKGRGYVDVGTSV
ISEFYTPLVPKGYDFLEEIKKLSNSRQSTQATCEAEVAGVD

  Protein domains


Predicted by InterproScan.

FtsK/SpoIIIE family (FtsK_SpoIIIE)

(217-301)

  Protein structure


Source ID Structure
AlphaFold DB B2IQE9


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 159930..171343

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SPCG_0154 155596..156969 + 1374 ACB89406 hypothetical protein -
SPCG_0155 156962..158023 + 1062 ACB89407 ABC transporter, ATP-binding protein -
SPCG_0156 158025..158717 + 693 ACB89408 ABC transporter, permease protein, putative -
SPCG_0157 158833..159606 + 774 ACB89409 transcriptional activator, Rgg/GadR/MutR family protein, C-terminal domain -
SPCG_0158 159788..159907 + 120 ACB89410 hypothetical protein -
SPCG_0159 159930..160244 + 315 ACB89411 hypothetical protein orf23
SPCG_0160 160260..160646 + 387 ACB89412 hypothetical protein orf23
SPCG_0161 160675..162060 + 1386 ACB89413 hypothetical protein virb4
SPCG_0162 162238..163443 + 1206 ACB89414 Tn916, transcriptional regulator, putative -
SPCG_0163 163486..163707 + 222 ACB89415 hypothetical protein orf19
SPCG_0164 163824..164321 + 498 ACB89416 hypothetical protein -
SPCG_0165 164296..164802 + 507 ACB89417 hypothetical protein orf17a
SPCG_0166 164735..167233 + 2499 ACB89418 hypothetical protein virb4
SPCG_0167 167236..169413 + 2178 ACB89419 hypothetical protein orf15
SPCG_0168 169410..170411 + 1002 ACB89420 hypothetical protein orf14
SPCG_0169 170408..171343 + 936 ACB89421 hypothetical protein orf13
SPCG_0170 171618..171704 + 87 ACB89422 tet(M) leader peptide -
SPCG_0171 171705..173639 + 1935 ACB89423 tetracycline resistance protein TetM -
SPCG_0172 174564..175301 + 738 ACB89424 rRNA methylase -
SPCG_0173 175656..176210 + 555 ACB89425 resolvase -

Region 2: 1284145..1308821

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SPCG_1292 1279959..1280609 - 651 ACB90544 chloramphenicol acetyltransferase -
SPCG_1293 1280780..1281028 - 249 ACB90545 hypothetical protein -
SPCG_1294 1281267..1282055 - 789 ACB90546 hypothetical protein -
SPCG_1295 1282531..1283289 - 759 ACB90547 hypothetical protein -
SPCG_1296 1283289..1283765 - 477 ACB90548 transcriptional regulator, putative -
SPCG_1297 1283835..1284107 - 273 ACB90549 hypothetical protein -
SPCG_1298 1284145..1284528 - 384 ACB90550 hypothetical protein gbs1346
SPCG_1299 1284525..1284758 - 234 ACB90551 hypothetical protein gbs1347
SPCG_1300 1284809..1285894 - 1086 ACB90552 hypothetical protein traP
SPCG_1301 1285904..1286545 - 642 ACB90553 parvulin-like peptidyl-prolyl isomerase prgL
SPCG_1302 1286705..1286902 + 198 ACB90554 hypothetical protein -
SPCG_1303 1286916..1287233 - 318 ACB90555 hypothetical protein gbs1350
SPCG_1304 1287226..1287510 - 285 ACB90556 hypothetical protein -
SPCG_1305 1287585..1293818 - 6234 ACB90557 SNF2 family protein -
SPCG_1306 1293851..1294261 - 411 ACB90558 hypothetical protein cd424
SPCG_1307 1294413..1295108 - 696 ACB90559 hypothetical protein -
SPCG_1308 1295217..1298030 - 2814 ACB90560 hypothetical protein prgK
SPCG_1309 1298042..1300357 - 2316 ACB90561 hypothetical protein virb4
SPCG_1310 1300347..1300709 - 363 ACB90562 hypothetical protein prgIc
SPCG_1311 1300763..1301617 - 855 ACB90563 hypothetical protein prgHb
SPCG_1312 1301634..1301876 - 243 ACB90564 hypothetical protein prgF
SPCG_1313 1301897..1303777 - 1881 ACB90565 hypothetical protein virb4
SPCG_1314 1303774..1304283 - 510 ACB90566 hypothetical protein gbs1365
SPCG_1315 1304252..1304551 - 300 ACB90567 hypothetical protein -
SPCG_1316 1304834..1305670 - 837 ACB90568 hypothetical protein -
SPCG_1317 1305670..1306314 - 645 ACB90569 hypothetical protein -
SPCG_1318 1306549..1306668 + 120 ACB90570 hypothetical protein -
SPCG_1319 1306691..1307005 + 315 ACB90571 hypothetical protein orf23
SPCG_1320 1307021..1307407 + 387 ACB90572 hypothetical protein orf23
SPCG_1321 1307436..1308821 + 1386 ACB90573 hypothetical protein virb4
SPCG_1322 1308999..1310417 + 1419 ACB90574 hypothetical protein -
SPCG_1323 1310674..1311459 + 786 ACB90575 erythromycin ribosome methylase -
SPCG_1324 1311797..1312339 + 543 ACB90576 streptothricin acetyltransferase -
SPCG_1325 1312432..1313226 + 795 ACB90577 aminoglycoside phosphotransferase type III -

Host bacterium

ID   47 Element type   Transposon
Element name   ICESpnCGSP14-1 GenBank   CP001033
Element size   2209198 bp Coordinate of oriT [Strand]   162035..162249 [+]
Host bacterium   Streptococcus pneumoniae CGSP14 Coordinate of element   159595..182718

Cargo genes

Drug resistance gene   tet(M), erm(B), cat(pC194), aph(3')-III
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA21