Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   200041
Name   oriT_ICESorUo5-1 in_silico
Organism   Streptococcus oralis Uo5
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   FR720602 (1826945..1827159 [+], 215 nt)
oriT length   215 nt
IRs (inverted repeats)      61..76, 80..95  (ACTTAACCCCCCGTAT..ACAGGGGGGTACAAAT)
  123..134, 139..150  (GAAAATCCTTTG..CAAGGGATTTAC)
Location of nic site      135..136
Conserved sequence flanking the
  nic site  
 
 TGG|T
Note   blastn alignment with the oriT_Tn916

  oriT sequence  


Download         Length: 215 nt

>oriT_ICESorUo5-1
AAGCGGAAGTCGCAGGTGTGGACTGATCTTGCTGGCTGGTGTGGCAATAGCCACGCCAGCACTTAACCCCCCGTATCTAACAGGGGGGTACAAATCGACAGGAAACAGTCAAAAAAACATTAGAAAATCCTTTGGTTACAAGGGATTTACAAAATTTCAGCGTATGTCAAATGGGCTTTAAAAGTTGACATACGCCTTTTTGATTGGAGGGATTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   255 GenBank   CBZ01516
Name   Relaxase_ICESorUo5-1 insolico UniProt ID   F2QFU7
Length   401 a.a. PDB ID   
Note   Tn916, transcriptional regulator, putative

  Relaxase protein sequence


Download         Length: 401 a.a.        Molecular weight: 47398.10 Da        Isoelectric Point: 6.5091

>CBZ01516.1 Tn916, transcriptional regulator, putative [Streptococcus oralis Uo5]
MEGFLLNEQTWLQHLKEKRLAYGLSQNRLAVATGITRQYLSDIETGKVKPSEDLQQSLWEALERFNPDAP
LEMLFDYVRIRFPTTDVQQVVENILQLKLSYFLHEDYGFYSYSEHYALGDIFVLCSHELDKGVLVELKGR
GCRQFESYLLAQQRSWYEFFMDVLVAGGVMKRLDLAINDKTGILNIPVLTEKCQQEECISVFRSFKSYRS
GELVRKEEKECMGNTLYIGSLQSEVYFCIYEKDYEQYKKNDIPIEDAEVKNRFEIRLKNERAYYAVRDLL
VYDNPEHTAFKIINRYIRFVDKDDSKPRSDWKLNEEWAWFIGNNRERLKLTTKPEPYSFQRTLNWLSHQV
APTLKVAIKLDEINQTQVVKDILDHAKLTDRHKQILKQQSVKEQDVITTKK

  Protein domains


Predicted by InterproScan.

(15-53)

(169-373)

(73-161)


  Protein structure


Source ID Structure
AlphaFold DB F2QFU7


T4CP


ID   255 GenBank   CBZ01515
Name   T4CP_ICESorUo5-1 insolico UniProt ID   F2QFU6
Length   389 a.a. PDB ID   _
Note   Tn916, FtsK/SpoIIIE family protein

  T4CP protein sequence


Download         Length: 389 a.a.        Molecular weight: 45150.43 Da        Isoelectric Point: 8.5669

>CBZ01515.1 Tn916, FtsK/SpoIIIE family protein [Streptococcus oralis Uo5]
MLVAFVFKRVRYDTVKQLYHRQKLAKMILENKWYESEQVKTEGFFKDSAGRTKEKITYFPKMYYRLKNGL
IQIRVEITLGKYQDQLLHLEKKLESGLYCELTDKELKDSYVEYTLLYDTIASRISIDEVEAKDGKLRLMK
NVWWEYDKLPHMLIAGGTGGGKTYFILTLIEALLHTDSKLYILDPKNADLADLGSVMANVYYRKEDLLSC
IETFYEEMMKRSEEMKQMKNYKTGKNYAYLGLPAHFLIFDEYVAFMEMLGTKENTAVMNKLKQIVMLGRQ
AGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGSDVQKDFFLKRIKGRGYVDVGTSVIS
EFYTPLVPKGYDFLEEIKKLSNSRQSTQATCEAEVAGVD

  Protein domains


Predicted by InterproScan.

(145-229)

  Protein structure


Source ID Structure
AlphaFold DB F2QFU6


T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 1824853..1836253

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SOR_1861 1820340..1822190 - 1851 CBZ01508 putative nucleoside-diphosphate sugar isomerase -
SOR_1862 1822266..1823096 - 831 CBZ01509 glycosyl transferase family 2 -
SOR_1863 1823318..1824484 + 1167 CBZ01510 putative cyanate permease -
SOR_1864 1824711..1824830 + 120 CBZ01511 Tn916 hypothetical protein -
SOR_1865 1824853..1825167 + 315 CBZ01512 Tn916 conserved hypothetical protein orf23
SOR_1866 1825183..1825569 + 387 CBZ01513 Tn916 conserved hypothetical protein orf23
SOR_1867 1825598..1825768 + 171 CBZ01514 Tn916, FtsK/SpoIIIE family protein -
SOR_1868 1825801..1826970 + 1170 CBZ01515 Tn916, FtsK/SpoIIIE family protein virb4
SOR_1869 1827148..1828353 + 1206 CBZ01516 Tn916, transcriptional regulator, putative -
SOR_1870 1828396..1828617 + 222 CBZ01517 Tn916 conserved hypothetical protein orf19
SOR_1871 1828734..1829231 + 498 CBZ01518 Tn916 conserved hypothetical protein -
SOR_1872 1829320..1829712 + 393 CBZ01519 Tn916 conserved hypothetical protein orf17a
SOR_1873 1829696..1832143 + 2448 CBZ01520 Tn916 conserved hypothetical protein virb4
SOR_1874 1832212..1834323 + 2112 CBZ01521 Tn916 conserved hypothetical protein orf15
SOR_1875 1834320..1835321 + 1002 CBZ01522 Tn916 protein; NLP/P60 family protein orf14
SOR_1876 1835336..1836253 + 918 CBZ01523 Tn916 conserved hypothetical protein orf13
SOR_1877 1836631..1838550 + 1920 CBZ01524 tetracycline resistance protein -
SOR_1878 1838896..1838979 - 84 CBZ01525 Tn916 conserved hypothetical protein; transcriptional regulator, putative -
SOR_1879 1839449..1839532 + 84 CBZ01526 23S rRNA methylase leader peptide -
SOR_1880 1839657..1840394 + 738 CBZ01527 erythromycin resistance protein; ribosomal RNA adenine N-6-methyltransferaseadenine dimethylase family protein -


Host bacterium


ID   46 Element type   Transposon
Element name   ICESorUo5-1 GenBank   FR720602
Element size   1958690 bp Coordinate of oriT [Strand]   1826945..1827159 [+]
Host bacterium   Streptococcus oralis Uo5 Coordinate of element   1824518..1847810

Cargo genes


Drug resistance gene   tet(M), erm(B)
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -