Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   200030
Name   oriT_Tn5397 in_silico
Organism   Clostridium difficile 630
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   AM180355 (587811..588025 [+], 215 nt)
oriT length   215 nt
IRs (inverted repeats)      61..76, 80..95  (ACTTAACCCCCCGTAT..ACAGGGGGGTACAAAT)
  125..134, 139..148  ( AAATCCTTTG.. CAAGGGATTT)
Location of nic site      135..136
Conserved sequence flanking the
  nic site  
 
 TGG|T
Note   blastn alignment with the oriT_Tn916

  oriT sequence  


Download         Length: 215 nt

>oriT_Tn5397
AAGCGGAAGTCGCAGGTGTGGACTAATCTTGCTGGCTGGTGTGGCGACAGCCACGCCAGCACTTAACCCCCCGTATCTAACAGGGGGGTACAAATCGACAGGAAACAGGCAAAAAAATAGTAGAAAATCCTTTGGTTACAAGGGATTTAGAAAATTTCGGTGTATGTCAAATGAGCTTTAAAAGTTGACATACGCCTTTTTGATTGGAGGAATTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   244 GenBank   CAJ67329
Name   CTn3-Orf20_Tn5397 insolico UniProt ID   Q188U0
Length   402 a.a. PDB ID   
Note   _

  Relaxase protein sequence


Download         Length: 402 a.a.        Molecular weight: 47304.05 Da        Isoelectric Point: 6.9549

>CAJ67329.1 putative replication initiation factor Tn5397,CTn3-Orf20 [Clostridioides difficile 630]
MIGGISLNEQTWVQHLKEKRLSYGLSQNRLAIATGITRQYLSDIETGKVKPSDELQLALLETLERFNPDA
PLEMLFDYVRIRFPTTDVQHVVEDVLRLKLSYMLHEDYGFYSYTEHYALGNIFVLCSHELDKGVLVELKG
RGCRQFESYLLAQQRSWYEFFMDALVASGVMKRLDLAINDKTGILNIPILTEKCRQEECISVFRSFKSYR
SGELVRKDEKECMGNTLYIGSLQSEVYFCIYEKDYEQYKKNDIPIEDAEVKNRFEIRLKNERAYYAVRDL
LAYDNPEHTAFKIINRYIRFVDKDDSKARSDWKLNEEWAWFIGNNRERLKLTTKPEPYSFQRTLNWLSHQ
VAPTLKVAITLDEINQTQVVKDILDHAKLTDRHKQILKQQSVKEQDVITNKK

  Protein domains


Predicted by InterproScan.

(16-63)

(170-374)

(74-162)


  Protein structure


Source ID Structure
AlphaFold DB Q188U0


T4CP


ID   244 GenBank   CAJ67327
Name   CTn3-Orf21_Tn5397 insolico UniProt ID   Q188U2
Length   461 a.a. PDB ID   _
Note   putative cell-division FtsK/SpoIIIE-family protein Tn5397, CTn3-Orf21

  T4CP protein sequence


Download         Length: 461 a.a.        Molecular weight: 53440.27 Da        Isoelectric Point: 8.2601

>CAJ67327.1 putative cell-division FtsK/SpoIIIE-family protein Tn5397, CTn3-Orf21 [Clostridioides difficile 630]
MKQRGKRIRPSDKDLVFHFTIASLLPVFLLVVGLFHVKTIQQINWQDLDLLQVDKIDIPYLVISFSVAIL
VCLLGAFIFRRYKYDMFKQLQHRQKLAKMILENKWYESEQVKTDGFFKDSTSRTKEKITYFPKMYYRLKD
GLISIRVEIMLGKYQDQLLHLEKKLESGLYCELTDKELKDSYVEYTLLYDTIANRLSIDEVQAKDGKLRL
MTNVWWEYDKLPHMLIAGGTGGGKTYFILTLIEALLHTNSKLTILDPKNADLADLGSVMGNVYYRKDDML
SCIDRFYDEMMKRSEVMKKMENYKTGENYAYLGLPAHFLIFDEYVAFMEMLGTKENTAVLNKLKQIVMLG
RQAGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGSDVQKDFFLKQIKGRGYVDVGTSV
ISEFYTPLVPKGHDFLEEIKRLSHSKQDTQATCEAEVAGVD

  Protein domains


Predicted by InterproScan.

(217-299)

  Protein structure


Source ID Structure
AlphaFold DB Q188U2


T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 585695..599749

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CD630_04910 (CD0491) 581655..582062 + 408 CAJ67320 PTS system, mannose/fructose/sorbose IIA component -
CD630_04920 (CD0492) 582091..582564 + 474 CAJ67321 PTS system, mannose/fructose/sorbose IIB component -
CD630_04930 (CD0493) 582611..583369 + 759 CAJ67322 PTS system, mannose/fructose/sorbose IIC component -
CD630_04940 (CD0494) 583393..584232 + 840 CAJ67323 PTS system, mannose/fructose/sorbose IID component -
CD630_04960 (CD0496) 585695..586009 + 315 CAJ67325 putative conjugative transposon protein DUF961 family Tn5397, CTn3-Orf23 orf23
CD630_04970 (CD0497) 586031..586417 + 387 CAJ67326 putative conjugative transposon protein DUF961 family Tn5397, CTn3-Orf22 orf23
CD630_04980 (CD0498) 586451..587836 + 1386 CAJ67327 putative cell-division FtsK/SpoIIIE-family protein Tn5397, CTn3-Orf21 virb4
CD630_04981 (CD0498A) 587839..587991 + 153 CAJ67328 putative conjugative transposon protein Tn5397,CTn3-Orf20.1 -
CD630_04990 (CD0499) 588010..589218 + 1209 CAJ67329 putative replication initiation factor Tn5397,CTn3-Orf20 -
CD630_04991 (CD0499A) 589261..589482 + 222 CAJ67330 putative conjugative transposon protein Tn5397,CTn3-Orf19 orf19
CD630_05000 (CD0500) 589599..590096 + 498 CAJ67331 putative antirestriction protein Tn5397,CTn3-Orf18 -
CD630_05010 (CD0501) 590184..590576 + 393 CAJ67332 putative conjugative transposon protein Tn5397,CTn3-Orf17 orf17a
CD630_05020 (CD0502) 590560..593007 + 2448 CAJ67333 putative ATPase Tn5397, CTn3-Orf16 virb4
CD630_05030 (CD0503) 593007..595175 + 2169 CAJ67334 putative membrane protein Tn5397, CTn3-Orf15 orf15
CD630_05040 (CD0504) 595172..598820 + 3649 Protein_529 Fragment of putative conjugative transposon protein Tn5397, CTn3-Orf14 -
CD630_05060 (CD0506) 596830..598659 + 1830 CAJ67336 Reverse transcriptase/maturase/endonuclease,Group II intron -
CD630_05070 (CD0507) 598817..599749 + 933 CAJ67337 putative conjugative transposon protein Tn5397,CTn3-Orf13 orf13
CD630_05071 (CD0507A) 599962..600018 + 57 Protein_532 Fragment of Tet(M) leader peptide Tn5397,CTn3-orf12 (C-terminal region) -
CD630_05080 (CD0508) 600034..601953 + 1920 CAJ67339 Tetracycline resistance protein Tn5397 -
CD630_05081 (CD0508A) 602049..602243 + 195 CAJ67340 putative conjugative transposon protein Tn5397,CTn3-Orf6 -
CD630_05090 (CD0509) 602302..602655 - 354 CAJ67341 Transcriptional regulator, HTH-type Tn5397,CTn3-Orf9 -
CD630_05091 (CD0509A) 602866..602931 + 66 CAJ67342 putative conjugative transposon protein Tn5397,CTn3-Orf10 -
CD630_05100 (CD0510) 603157..603582 + 426 CAJ67343 putative RNA polymerase sigma factor Tn5397,CTn3-Orf7 -
CD630_05101 (CD0510A) 603579..603809 + 231 CAJ67344 putative conjugative transposon protein Tn5397,CTn3-Orf8 -
CD630_05102 (CD0510B) 603931..604068 - 138 Protein_539 Fragment of putative conjugative transposon protein Tn5397, CTn3-Orf5 (C-terminal region) -
CD630_05103 (CD0510C) 604190..604330 + 141 CCA62796 putative conjugative transposon protein Tn5397,CTn3-Orf4 -

Region 2: 3897502..3910292

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CD630_33280 (CD3328) 3892914..3893153 - 240 CAJ70225 putative conjugative transposon protein Tn916-like, CTn6-Orf4 -
CD630_33290 (CD3329) 3893150..3893572 - 423 CAJ70226 putative RNA polymerase sigma factor Tn916-like,CTn6-Orf5 -
CD630_33300 (CD3330) 3894170..3894526 + 357 CAJ70227 Transcriptional regulator, HTH-type Tn916-like,CTn6-Orf6 -
CD630_33310 (CD3331) 3894559..3895254 - 696 CAJ70228 putative conjugative transposon protein Tn916-like, CTn6-Orf7 -
CD630_33320 (CD3332) 3895434..3896003 + 570 CAJ70229 Transcriptional regulator, TetR family; Tn916-like, CTn6-Orf8 -
CD630_33330 (CD3333) 3896015..3896260 + 246 CAJ70230 putative conjugative transposon protein Tn916-like, CTn6-Orf9 -
CD630_33331 (CD3333A) 3896491..3896733 + 243 CAJ70231 putative conjugative transposon protein Tn916-like, CTn6-Orf10 -
CD630_33340 (CD3334) 3896730..3897200 + 471 CAJ70232 putative transcriptional regulator Tn916-like,CTn6-Orf11 -
CD630_33350 (CD3335) 3897502..3898410 - 909 CAJ70233 putative conjugative transposon protein Tn916-like, CTn6-Orf12 orf13
CD630_33360 (CD3336) 3898427..3899431 - 1005 CAJ70234 putative cell wall hydrolase Tn916-like,CTn6-Orf13 orf14
CD630_33370 (CD3337) 3899428..3901809 - 2382 CAJ70235 putative membrane protein Tn916-like,CTn6-Orf14 orf15
CD630_33380 (CD3338) 3901806..3904259 - 2454 CAJ70236 putative ATPase Tn916-like, CTn6-Orf15 virb4
CD630_33390 (CD3339) 3904243..3904635 - 393 CAJ70237 putative conjugative transposon protein Tn916-like, CTn6-Orf16 orf17a
CD630_33400 (CD3340) 3904725..3905222 - 498 CAJ70238 putative antirestriction protein Tn916-like,CTn6-Orf17 -
CD630_33410 (CD3341) 3905328..3905732 - 405 Protein_3532 Fragment of putative conjugative transposon protein Tn916-like, CTn6-Orf18 (N-terminal region) -
CD630_33420 (CD3342) 3905806..3906312 - 507 CAJ70240 putative conjugative transposon protein Tn916-like, CTn6-Orf19 -
CD630_33421 (CD3342A) 3906498..3906719 - 222 CAJ70241 putative conjugative transposon protein Tn916-like, CTn6-Orf20 orf19
CD630_33430 (CD3343) 3906771..3907751 - 981 CAJ70242 putative replication initiation factor Tn916-like, CTn6-Orf21 -
CD630_33440 (CD3344) 3908146..3909543 - 1398 CAJ70243 putative cell-division FtsK/SpoIIIE-family protein Tn916-like, CTn6-Orf22 virb4
CD630_33450 (CD3345) 3909579..3909956 - 378 CAJ70244 putative conjugative transposon protein Tn916-like, CTn6-Orf23 orf23
CD630_33460 (CD3346) 3909978..3910292 - 315 CAJ70245 putative conjugative transposon protein DUF961 family Tn916-like, CTn6-Orf24 orf23
CD630_33470 (CD3347) 3910549..3911223 + 675 CAJ70246 putative membrane protein -
CD630_33480 (CD3348) 3911224..3912117 + 894 CAJ70247 conserved hypothetical protein -
CD630_33490 (CD3349) 3912316..3914301 - 1986 CAJ70248 Exosporium glycoprotein BclA3 -


Host bacterium


ID   35 Element type   
Element name   Tn5397 GenBank   AM180355
Element size   4290252 bp Coordinate of oriT [Strand]   587811..588025 [+]
Host bacterium   Clostridium difficile 630 Coordinate of element   585384..606040

Cargo genes


Drug resistance gene   tet(M)
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -