Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   200009
Name   oriT_Tn4399 experimental
Organism   Bacteroides fragilis
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   L20975 (991..1189 [+], 199 nt)
oriT length   199 nt
IRs (inverted repeats)      98..106, 113..122  (TTCCCCTCA..TGAGGGGCAA)
  126..135, 139..148  (GTCGGGGAAT..ATACGCCGAC)
Location of nic site      156..157
Conserved sequence flanking the
  nic site    		  _
Note   _

  oriT sequence  


Download         Length: 199 nt

>oriT_Tn4399
TAAGGTGATTATGTTGTTTTTCTTCATCTGTTCTATCTGTTTTTTAGTGAATAATCCGATTGATGTAATCTGAAAAGTCCGTGACCATCGGGAGCCGTTCCCCTCATCTTTTTGAGGGGCAAGTGGTCGGGGAATGTAATACGCCGACATTAACTTGCTATCCTAAAAAAGATGTGATTTACGGCTTAGATGCCGAATC

Visualization of oriT structure (The oriT was characterized experimentally)

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Vedantam G et al. (2006) Bacteroides fragilis mobilizable transposon Tn5520 requires a 71 base pair origin of transfer sequence and a single mobilization protein for relaxosome formation during conjugation. Mol Microbiol. 59(1):288-300. [PMID:16359335]
[2] Murphy CG et al. (1995) Requirements for strand- and site-specific cleavage within the oriT region of Tn4399, a mobilizing transposon from Bacteroides fragilis. J Bacteriol. 177(11):3158-65. [PMID:7768814]
[3] Hecht DW et al. (1989) Tn4399, a conjugal mobilizing transposon of Bacteroides fragilis. J Bacteriol. 171(7):3603-8. [PMID:2544548]


Relaxase

ID   223 GenBank   AAA98401
Name   MocA_Tn4399 insolico UniProt ID   Q56424
Length   318 a.a. PDB ID   
Note   relaxase

  Relaxase protein sequence


Download         Length: 318 a.a.        Molecular weight: 36395.16 Da        Isoelectric Point: 9.1608

>AAA98401.1 MocA [Bacteroides fragilis]
MIGKQTKGTSFSGCVCYVLREDKSKLLEAVGVEGTPEQMAEQFELQTLLNDKVKNTVGHTSLNFSPEDGE
RLKTDDALMLQIAHDYMAKMGIENTQYIVARHTDREHPHCHIVFNRVDNDGKTISDKNDFYRNEKVCKML
TAKYRLHFANGKDNIKEERLRPYDKAKHEVYKALKGELPHARSWNELKEALSERDIELKFKVSRTTKEVQ
GVKFEYGGISFSGSKVSREFSYMNIDYRLRRNAFEDDFNHRQAAIREPGEEAVQTVSQNRSKDSVGNGLG
LFSGIGSSFDVADAEANQEMAEILRKKKKAKRKRGMRL

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(8-241)


  Protein structure


Source ID Structure
AlphaFold DB Q56424

  Reference


[1] Murphy CG et al. (1995) Requirements for strand- and site-specific cleavage within the oriT region of Tn4399, a mobilizing transposon from Bacteroides fragilis. J Bacteriol. 177(11):3158-65. [PMID:7768814]


Auxiliary protein

ID   311 GenBank   AAA98400
Name   MocB_Tn4399 insolico UniProt ID   Q56423
Length   143 a.a. PDB ID   _
Note   Bacterial mobilisation protein (MobC)

  Auxiliary protein sequence


Download         Length: 143 a.a.        Molecular weight: 16400.86 Da        Isoelectric Point: 10.6958

>AAA98400.1 MocB [Bacteroides fragilis]
MSAYYIPRPLAPQKDEGNGSRWSRTFQITSIGLFTKKQIEQMKKNNIITLRLTDDELGWLGALCRRSRQS
KSETIRSLIMNGTVRERINKEHLAVIRQLIGESTNLNQLARQANTYGFFAVADKCENMAKAVSQLINRLK
DDR

  Protein domains


Predicted by InterproScan.

Bacterial mobilisation protein (MobC) (MobC)

(96-139)


  Protein structure


Source ID Structure
AlphaFold DB Q56423

  Reference


[1] Murphy CG et al. (1995) Requirements for strand- and site-specific cleavage within the oriT region of Tn4399, a mobilizing transposon from Bacteroides fragilis. J Bacteriol. 177(11):3158-65. [PMID:7768814]


Host bacterium

ID   14 Element type   ICE (Integrative and conjugative element)
Element name   Tn4399 GenBank   L20975
Element size   2854 bp Coordinate of oriT [Strand]   991..1189 [+]
Host bacterium   Bacteroides fragilis

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -