Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   200008
Name   oriT_Tn4555 experimental
Organism   Bacteroides fragilis
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   U75371 (6390..6563 [+], 174 nt)
oriT length   174 nt
IRs (inverted repeats)      20..24, 29..33  (CTACG..CGGAG)
  57..63, 66..72  (CAATGGC..GCCATTG)
  104..110, 112..118  (CCTCCGT..AGGGAGG)
Location of nic site      50..51
Conserved sequence flanking the
  nic site    		  _
Note   Its oriT shows significant homology to the nic sites of the pMV158-oriT family.

  oriT sequence  


Download         Length: 174 nt

>oriT_Tn4555
CCCTCGGGAGAGCCCACAACTACGTAAGCGGAGCGTGTAGTTATAGTGGGCTATATCAATGGCAAGCCATTGTCTGCAAACTCCAGCCTACGGCTTCCGCTCTCCTCCGTCAGGGAGGTTTTTCATCATCGTTGCCGATTGGAGATGCACCGACCAGCACAAGGTCTAAATCGT

Visualization of oriT structure (The oriT was characterized experimentally)

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Vedantam G et al. (2006) Bacteroides fragilis mobilizable transposon Tn5520 requires a 71 base pair origin of transfer sequence and a single mobilization protein for relaxosome formation during conjugation. Mol Microbiol. 59(1):288-300. [PMID:16359335]
[2] Grohmann E et al. (2003) Conjugative plasmid transfer in gram-positive bacteria. Microbiol Mol Biol Rev. 67(2):277-301. [PMID:12794193]
[3] Grohmann E et al. (1999) Mobilisation of the streptococcal plasmid pMV158: interactions of MobM protein with its cognate oriT DNA region. Mol Gen Genet. 261(4-5):707-15. [PMID:10394908]
[4] Tribble GD et al. (1997) The Bacteroides mobilizable transposon Tn4555 integrates by a site-specific recombination mechanism similar to that of the gram-positive bacterial element Tn916. J Bacteriol. 179(8):2731-9. [PMID:9098073]


Relaxase

ID   222 GenBank   AAD43599
Name   MobA_Tn4555 insolico UniProt ID   Q9XBG8
Length   519 a.a. PDB ID   
Note   relaxase

  Relaxase protein sequence


Download         Length: 519 a.a.        Molecular weight: 60799.48 Da        Isoelectric Point: 10.0344

>AAD43599.1 mobilization protein [Bacteroides fragilis]
MTHSGRFSPENPEQRVTLSLQSPLMGCTPKNPMRLRTAEKQTIKYKPKKQVSMATKSSIHIKPCNIASSE
AHNRRTAEYMRHIGESRTYVVPELSTDNEQWINPDFGSPDLRMHYDNIRQMVKEKTGRAMQEKERERKGK
NGKIVKIAGCSPIREGVLLVRSDTTLADVRKFGEECQRRWGITPLQIFLHKDEGHWLNGQPEAEDRESFK
VGDRWFKPNYHAHIVFDWMNHETGKSRKLNDDDMMQMQTLASDILLMERGQSKAVTGKEHLERNDFIIEK
QKAELQRMDAAKRHKEEQINLAEQELKQVKSEIRTDKLKKTATTAATAITSGVASLFGSGKLKELERANE
KLQDEVSKRNTNIEKLQSQVQQMSETAYTQIHNLREMHRQELDMKEKELSRLARIIDKAFRWFPMFREML
RMEKFCAMLGFSKEMTESLIVKKEALKCSGKIYSEQHRRNFDIKDDILRVENDPDDESRLNLTINRKPIA
DWFREQWHRLRYGARVPQQEERKSRGFKL

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB Q9XBG8

  Reference


[1] Tribble GD et al. (1997) The Bacteroides mobilizable transposon Tn4555 integrates by a site-specific recombination mechanism similar to that of the gram-positive bacterial element Tn916. J Bacteriol. 179(8):2731-9. [PMID:9098073]
[2] Smith CJ et al. (1996) A gene product related to Tral is required for the mobilization of Bacteroides mobilizable transposons and plasmids. Mol Microbiol. 20(4):741-50. [PMID:8793871]


Host bacterium

ID   13 Element type   IME (Integrative mobilizable element)
Element name   Tn4555 GenBank   U75371
Element size   12105 bp Coordinate of oriT [Strand]   6390..6563 [+]
Host bacterium   Bacteroides fragilis

Cargo genes

Drug resistance gene   cfxA
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -