Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   200007
Name   oriT_Tn5520 experimental
Organism   Bacteroides fragilis
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   AF038866 (2321..2391 [+], 71 nt)
oriT length   71 nt
IRs (inverted repeats)      14..30, 55..71  (CTTATTAGGGAATTTTC..GAAAATTCCCCAATAAG)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   71 bp minimal oriT

  oriT sequence  


Download         Length: 71 nt

>oriT_Tn5520
CTTATTGGGGAATTTTCAGCGATACGGAGTATTGCGGCTCGGAAAATTCCCTAATAAGCTACGGTATTTTC

Visualization of oriT structure (The oriT was characterized experimentally)

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Vedantam G et al. (2006) Bacteroides fragilis mobilizable transposon Tn5520 requires a 71 base pair origin of transfer sequence and a single mobilization protein for relaxosome formation during conjugation. Mol Microbiol. 59(1):288-300. [PMID:16359335]


Relaxase


ID   221 GenBank   AAD24590
Name   BmpH_Tn5520 insolico UniProt ID   Q9X2P3
Length   455 a.a. PDB ID   
Note   relaxase

  Relaxase protein sequence


Download         Length: 455 a.a.        Molecular weight: 52650.07 Da        Isoelectric Point: 10.0660

>AAD24590.1 mobilization protein BmpH [Bacteroides fragilis]
MGFVVLHMEKAHGSDSGTTAHIERFIIPKNADPTHTYLNRRLIDYPDGVKDRSAAIQQRLEEAGLTRKIG
SNQVRAIRINVSGTHEDMKRIEEEGRLDEWCADNLKYFADTFGKENIVAAHLHRDEETPHIHVTLVPIVK
GERKRRKREEQTKKRYRKKPTNTVRLCADDIMTRLKLKSYQDTYAEAMAKYGLQRGIDGSKARHKSTQQY
YRDIQKLADNLKAEVVDLQQQKETAREELRRAKKEIQTEKLKGVATVAAANIAESVGSLFGSNKVKTLER
ENTALHREVADHEETIEALQDKIQTMQADHSRQMAEVERKHRREIADKETKHKEEISFLKTVIAKAAAWF
PYFREMLRIENLCRLIGFDERQTATLVKGKPLEYAGELYSEEHGRKFTTEKAGFQVVKDPTDGTRLVLAI
DRKPIAEWFKEQFEKVRQNIRRPIQLQKKGRGMKL

  Protein domains


Predicted by InterproScan.

(3-211)


  Protein structure


Source ID Structure
AlphaFold DB Q9X2P3

  Reference


[1] Vedantam G et al. (2006) Bacteroides fragilis mobilizable transposon Tn5520 requires a 71 base pair origin of transfer sequence and a single mobilization protein for relaxosome formation during conjugation. Mol Microbiol. 59(1):288-300. [PMID:16359335]


Host bacterium


ID   12 Element type   IME (Integrative mobilizable element)
Element name   Tn5520 (chromosomal Tn) GenBank   AF038866
Element size   4692 bp Coordinate of oriT [Strand]   2321..2391 [+]
Host bacterium   Bacteroides fragilis

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -