Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   122563
Name   oriT1_pA12-3 in_silico
Organism   Lactococcus lactis subsp. lactis strain A12
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_LT599052 (21283..21419 [+], 137 nt)
oriT length   137 nt
IRs (inverted repeats)      21..28, 42..49  (AAAAGGGG..CCCCTTTT)
 25..30, 39..44  (GGGGAA..TTCCCC)
Location of nic site      104..105
Conserved sequence flanking the
  nic site    		  GCTTGCAGTA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 137 nt

>oriT1_pA12-3
CGACACAATCCAAAGGGGATAAAAGGGGAAAGTGAAACTTCCCCCTTTTCAAGCCACATTGTAATACAAGAACGAAGTGCTTTGTATTACAATGTGATAGCTTGCAGTATTTATGGCTTTATATGGTCTATTTTGTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   14226 GenBank   WP_021721723
Name   Relaxase_LLA12_RS13010_pA12-3 insolico UniProt ID   S6EVE0
Length   85 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 85 a.a.        Molecular weight: 9713.03 Da        Isoelectric Point: 10.2135

>WP_021721723.1 relaxase/mobilization nuclease domain-containing protein [Lactococcus lactis]
MTVTKTIQIKSESQLGRALEYITNAKKTINETLVSGHALNNVHNAEFEMLRTRRFAQKLKGHYSNGKDEV
FAHHIIQSFDPKDKS

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB S6EVE0


Host bacterium

ID   22989 GenBank   NZ_LT599052
Plasmid name   pA12-3 Incompatibility group   -
Plasmid size   42401 bp Coordinate of oriT [Strand]   21283..21419 [+]; 30611..30746 [+]
Host baterium   Lactococcus lactis subsp. lactis strain A12

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrID1