Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   122463
Name   oriT1_EB_P8_L5_01.19|unnamed5 in_silico
Organism   Enterobacter kobei strain EB_P8_L5_01.19
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP043517 ( 8367..8426 [+], 60 nt)
oriT length   60 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 60 nt

>oriT1_EB_P8_L5_01.19|unnamed5
GGGTTTCGGGGCGCAGCCCTGAACCAGTCACGCAGCGCTAGCGGAGTGTATACTGGCTTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   14166 GenBank   WP_172971212
Name   Relaxase_FZO55_RS26000_EB_P8_L5_01.19|unnamed5 insolico UniProt ID   _
Length   225 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 225 a.a.        Molecular weight: 24822.12 Da        Isoelectric Point: 8.3767

>WP_172971212.1 relaxase/mobilization nuclease domain-containing protein [Enterobacter kobei]
MMIVKFHPRGRGGGSGPVDYLLGKDRQREGASVLQGKPEEVRELIDASPYAKKYTSGVLSFAEKDLPPGQ
REKLMASFERVLMPGLDKDQYSVLWVEHQDKGRLELNFLIPNTELLTGRRLQPYYDRADRPRIDAWQTIV
NGRLGLHDPNAPENRRALVTPSALPEAKQEAAQAITRGLLALASSGELKTRQDVTDALESAGFEVIRTTK
AASALPTRTGGETSD

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(57-210)


  Protein structure



No available structure.




Auxiliary protein

ID   7835 GenBank   WP_238337823
Name   WP_238337823_EB_P8_L5_01.19|unnamed5 insolico UniProt ID   _
Length   99 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 99 a.a.        Molecular weight: 11058.75 Da        Isoelectric Point: 10.1120

>WP_238337823.1 hypothetical protein [Enterobacter kobei]
MSQRTKGMLRMVSQTWLTIVLVSVLLIASSAGILWWQGQQILDNYTTIREQKSTQAILSERNSGVQLSTC
GEQGRRCVRVNPEAGRFGEDSSWMILAGK

  Protein domains



No domain identified.



  Protein structure



No available structure.



ID   7836 GenBank   WP_172971213
Name   WP_172971213_EB_P8_L5_01.19|unnamed5 insolico UniProt ID   _
Length   107 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 107 a.a.        Molecular weight: 11868.66 Da        Isoelectric Point: 9.4893

>WP_172971213.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Enterobacteriaceae]
MLTMWVTDDEHRRLLERCDGKQLAAWMRQTCLDEKPARAGKLPSISPALLRQLAGMGNNLNQIARRVNAG
GGTGHDRVQIVAALMAIDAGLERLRHAVLDKGRDDDR

  Protein domains


Predicted by InterproScan.

Bacterial mobilisation protein (MobC) (MobC)

(50-94)


  Protein structure



No available structure.



ID   7836 GenBank   WP_172971213
Name   WP_172971213_EB_P8_L5_01.19|unnamed5 insolico UniProt ID   _
Length   107 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 107 a.a.        Molecular weight: 11868.66 Da        Isoelectric Point: 9.4893

>WP_172971213.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Enterobacteriaceae]
MLTMWVTDDEHRRLLERCDGKQLAAWMRQTCLDEKPARAGKLPSISPALLRQLAGMGNNLNQIARRVNAG
GGTGHDRVQIVAALMAIDAGLERLRHAVLDKGRDDDR

  Protein domains


Predicted by InterproScan.

Bacterial mobilisation protein (MobC) (MobC)

(50-94)


  Protein structure



No available structure.




Host bacterium

ID   22889 GenBank   NZ_CP043517
Plasmid name   EB_P8_L5_01.19|unnamed5 Incompatibility group   Col440II
Plasmid size   9964 bp Coordinate of oriT [Strand]   2844..2903 [+]; 8367..8426 [+]
Host baterium   Enterobacter kobei strain EB_P8_L5_01.19

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -