Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   122441
Name   oriT_pKAM576_6 in_silico
Organism   Enterobacter asburiae strain KAM576
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_AP026892 (914..973 [+], 60 nt)
oriT length   60 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 60 nt

>oriT_pKAM576_6
GGGTTTCGGGGCGCAGCCCTGAACCAGTCACGTAGCGCTAGCGGAGTGTATACTGGCTTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   14147 GenBank   WP_264885052
Name   Relaxase_OO861_RS25055_pKAM576_6 insolico UniProt ID   _
Length   166 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 166 a.a.        Molecular weight: 18554.11 Da        Isoelectric Point: 9.2755

>WP_264885052.1 relaxase/mobilization nuclease domain-containing protein [Enterobacter asburiae]
MIVKFHPRGRGGGAGPVDYLLGKDRQREGASVLQGKPEEVRELIDASPYVKKYTSGVLSFAEADLPPGQR
EKLMASFERVLMPGLDKDQYSILWVEHADKGRLELNFLIPNTELLTGRRLQPYYDRADRPRIDAWQTIVN
GRLGLHDPNAPENRRALVTPSGPGGH

  Protein domains


Predicted by InterproScan.

(57-156)


  Protein structure



No available structure.




Auxiliary protein


ID   7830 GenBank   WP_264885053
Name   WP_264885053_pKAM576_6 insolico UniProt ID   _
Length   107 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 107 a.a.        Molecular weight: 11791.57 Da        Isoelectric Point: 8.5792

>WP_264885053.1 MobC family plasmid mobilization relaxosome protein [Enterobacter asburiae]
MLTMWVTEGEHRRLLERCDGRPLAAWMRQTCLDEKPARTGKLPSLSPALLRQLAGMGNNLNQIARHVNAG
GGTGHDRVQIVAALMAIDAGLERLRHAVLEKGTDDDR

  Protein domains


Predicted by InterproScan.

(50-94)


  Protein structure



No available structure.




Host bacterium


ID   22867 GenBank   NZ_AP026892
Plasmid name   pKAM576_6 Incompatibility group   Col440II
Plasmid size   3701 bp Coordinate of oriT [Strand]   914..973 [+]
Host baterium   Enterobacter asburiae strain KAM576

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -