Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   122376
Name   oriT1_pECD227_46 in_silico
Organism   Escherichia fergusonii ECD227
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CM001145 (16764..16844 [-], 81 nt)
oriT length   81 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 81 nt

>oriT1_pECD227_46
GGGGTGCCGGGGCAAAGCCCTGACCAGACAGCAAAAGGAATATCGTCTCGGGTGACGGTATTACATTTGAACATTCTGTCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   14113 GenBank   WP_255121813
Name   Relaxase_ECD227_RS27230_pECD227_46 insolico UniProt ID   _
Length   203 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 203 a.a.        Molecular weight: 23407.01 Da        Isoelectric Point: 6.2180

>WP_255121813.1 relaxase/mobilization nuclease domain-containing protein, partial [Escherichia fergusonii]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGF

  Protein domains


Predicted by InterproScan.

(62-203)


  Protein structure



No available structure.




Auxiliary protein


ID   7815 GenBank   WP_032243529
Name   WP_032243529_pECD227_46 insolico UniProt ID   _
Length   87 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 87 a.a.        Molecular weight: 9995.49 Da        Isoelectric Point: 11.3946

>WP_032243529.1 IncI1-type relaxosome accessory protein NikA, partial [Escherichia fergusonii]
MSDSGVRKKSEVRQKTVVRTLRFSPAEDETIRKKAEDSGLTVSAYIRNAALNKRINSRTDDAFLKELMRL
GRMQKHLFVQGKRTGDR

  Protein domains



No domain identified.



  Protein structure



No available structure.




Host bacterium


ID   22802 GenBank   NZ_CM001145
Plasmid name   pECD227_46 Incompatibility group   IncX1
Plasmid size   45663 bp Coordinate of oriT [Strand]   16764..16844 [-]; 40224..40311 [+]
Host baterium   Escherichia fergusonii ECD227

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -