Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   122360
Name   oriT1_IMT49658-1|unnamed4 in_silico
Organism   Enterobacter hormaechei strain IMT49658-1
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP135274 ( 9261..9320 [-], 60 nt)
oriT length   60 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 60 nt

>oriT1_IMT49658-1|unnamed4
GGGTTTCGGGGCGCAGCCCTGAACCAGTCACGTAGCGCTAGCGGAGTGTATACTGGCTTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   14099 GenBank   WP_315451647
Name   Relaxase_RP424_RS25350_IMT49658-1|unnamed4 insolico UniProt ID   _
Length   224 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 224 a.a.        Molecular weight: 24794.99 Da        Isoelectric Point: 6.2802

>WP_315451647.1 relaxase/mobilization nuclease domain-containing protein [Enterobacter hormaechei]
MIVKFHPRGRGGGAGPVDYLLGKDRQRDGATVLQGKPEEVRELIDASPYVKKYTSGVLSFAEADLPPGQR
EKLMASFERVLMPGLDKDQYSILWVEHEDKGRLELNFLIPNTELLTGRRLQPYYDRADRPRIDAWQTIVN
GRLGLHDPNAPENRRALVTPSGLPKTKQEAAEAITRGLLTLASSGELKSRQDVTEALERSGFEVVRTTKS
SISIADPDGGETSD

  Protein domains


Predicted by InterproScan.

(57-214)


  Protein structure



No available structure.




Auxiliary protein


ID   7812 GenBank   WP_180241484
Name   WP_180241484_IMT49658-1|unnamed4 insolico UniProt ID   _
Length   107 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 107 a.a.        Molecular weight: 11929.70 Da        Isoelectric Point: 8.5732

>WP_180241484.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Enterobacteriaceae]
MLTMWVTEDEHRRLLERCDGRQLAAWMRQTCLDEKPARTGKLPSISPALLRQLAGMGNNLNQIARRVNAG
GGTGHDRVQIVAALMTIDAGLERLRHAVLEKGTDDDR

  Protein domains


Predicted by InterproScan.

(50-94)


  Protein structure



No available structure.



ID   7812 GenBank   WP_180241484
Name   WP_180241484_IMT49658-1|unnamed4 insolico UniProt ID   _
Length   107 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 107 a.a.        Molecular weight: 11929.70 Da        Isoelectric Point: 8.5732

>WP_180241484.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Enterobacteriaceae]
MLTMWVTEDEHRRLLERCDGRQLAAWMRQTCLDEKPARTGKLPSISPALLRQLAGMGNNLNQIARRVNAG
GGTGHDRVQIVAALMTIDAGLERLRHAVLEKGTDDDR

  Protein domains


Predicted by InterproScan.

(50-94)


  Protein structure



No available structure.




Host bacterium


ID   22786 GenBank   NZ_CP135274
Plasmid name   IMT49658-1|unnamed4 Incompatibility group   ColRNAI
Plasmid size   12725 bp Coordinate of oriT [Strand]   2897..2956 [-]; 9261..9320 [-]
Host baterium   Enterobacter hormaechei strain IMT49658-1

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -