Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   122320
Name   oriT1_pZJDX3 in_silico
Organism   Pseudomonas ficuserectae strain ZJDX-003
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP085687 ( 44552..44730 [-], 179 nt)
oriT length   179 nt
IRs (inverted repeats)      81..88, 92..99  (CAAAGGGG..CCCCTTTG)
 43..48, 57..62  (AAAAAG..CTTTTT)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 179 nt

>oriT1_pZJDX3
AATCTCGAATTCGCTAAACAGGCACGTTACCGATTGTCTACAAAAAAGAGCTTCGCCTTTTTCGTATCCAATCGACGTGCCAAAGGGGATACCCCTTTGAAACCCCGCAGAGCGGGAAAGCGTTGTCGTTGTTGTTGGTTGTCGTCATTCCAGGTGCCCCCAGGAGGTGATCTTGTGGC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   14078 GenBank   WP_257113108
Name   MobA_MobL_LJU29_RS29155_pZJDX3 insolico UniProt ID   _
Length   144 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 144 a.a.        Molecular weight: 16162.44 Da        Isoelectric Point: 10.9207

>WP_257113108.1 MobA/MobL family protein [Pseudomonas ficuserectae]
MTHPEIRFLNRRIRGRSQAKTEAETIAIFHASTKPIARSAGRSYVAAAYRSGTKLVDIRTSLVHDYTRRG
GVFSTEIMFPDGTSTERNALWNAAESAEKRKDGRTGREWIIALPAELDDGARQKLVSAFGIKLANLLPFQ
MIWQ

  Protein domains


Predicted by InterproScan.

MobA/MobL family (MobA_MobL)

(45-129)


  Protein structure



No available structure.




Host bacterium

ID   22747 GenBank   NZ_CP085687
Plasmid name   pZJDX3 Incompatibility group   -
Plasmid size   53270 bp Coordinate of oriT [Strand]   10277..10455 [-]; 44552..44730 [-]
Host baterium   Pseudomonas ficuserectae strain ZJDX-003

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -