Detailed information of oriT

oriT

The information of the oriT region

• oriTDB ID: 122254
• Name: oriT1_MMP1|unnamed 1
• Organism: Staphylococcus warneri strain MMP1
• Sequence Completeness: -
• NCBI accession of oriT (coordinates [strand]): NZ_CM007783 (241..314 [-], 74 nt)
• oriT length: 74 nt
• IRs (inverted repeats): 53..59, 63..69 (ATGGGGA..TCCCCAT) 24..29, 42..47 (TTTTGT..ACAAAA) 21..29, 34..42 (TATTTTTGT..ACAAAAATA) 1..8, 14..21 (AGTGGCTA..TAGCCACT)
• Location of nic site: _
• Conserved sequence flanking the nic site: _
• Note: Predicted by oriTfinder 2.0

oriT sequence

• Length: 74 nt

>oriT1_MMP1|unnamed 1
AGTGGCTAGCAATTAGCCACTATTTTTGTGCCAACAAAAATACAAAAGGGGCATGGGGATATTCCCCATCAAGC

oriT secondary structure

Predicted by RNAfold.

Relaxase

Rep_trans_ATY33_RS00010_MMP1|unnamed 1

• ID: 14033
• GenBank: WP_079448951
• Name: Rep_trans_ATY33_RS00010_MMP1|unnamed 1
• UniProt ID: _
• Length: 311 a.a.
• Note: Predicted by oriTfinder 2.0

Relaxase protein sequence

• Length: 311 a.a.
• Molecular weight: 37504.78 Da
• Isoelectric Point: 9.3193

>WP_079448951.1 replication initiation factor domain-containing protein [Staphylococcus warneri]
MTEENHSNHLQNKYSDSLSKTGYSNSRLSAQIPVQTYPNLSFDAMTIVGNLNKVNAQKLSEFMSIEPQIR
LWDILRTKFKAKALQEKVYIEYDKVKADTWDRRNMRVEFNPNKLSQEEMLWLKQNIIDYMEDDGFTRLDL
AFDFEDDLSDYYAMTDKAVKKTVFYGRNGKPETKYFGVRDSDRFIRIYNKKQERKDNADVEVMSKHLWRV
EIELKRNMVDYWNDCFNDLHILKPDYTMINKTSERHTVMALLFDESEWGKLNRNTKYKFKKIFKEISPID
LTDLMKQTLKAKEKQLQKQIDFWQREFRFWK

Protein domains

Predicted by InterproScan.

• Replication initiation factor (Rep_trans) (135-292)

Protein structure

No available structure.

Host bacterium

• ID: 22681
• GenBank: NZ_CM007783
• Plasmid name: MMP1|unnamed 1
• Incompatibility group: -
• Plasmid size: 4058 bp
• Coordinate of oriT [Strand]: 241..314 [-]; 3941..4038 [-]
• Host baterium: Staphylococcus warneri strain MMP1

Cargo genes

• Drug resistance gene: -
• Virulence gene: -
• Metal resistance gene: -
• Degradation gene: -
• Symbiosis gene: -
• Anti-CRISPR: -