Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   122124
Name   oriT_Col440II in_silico
Organism   Enterobacter hormaechei subsp. xiangfangensis strain CNCI 200
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_JAPZPX010000073 (1220..1277 [+], 58 nt)
oriT length   58 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 58 nt

>oriT_Col440II
GGGTTTCGGGGCGCAGCCCTGAACCAGTCACGTAGCGCTAGCGGAGTGTATACTGGCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   13946 GenBank   WP_310856480
Name   Relaxase_O8F33_RS25500_Col440II insolico UniProt ID   _
Length   225 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 225 a.a.        Molecular weight: 25016.50 Da        Isoelectric Point: 10.3640

>WP_310856480.1 relaxase/mobilization nuclease domain-containing protein [Enterobacter hormaechei]
MMIVKFHPRGRGGGAGPVDYLLGKDRQREGATVLQGKPEEVRELIDASPYAKKYTSGVLSFAEAELPPGQ
REQIMASFERVLMPGLDKDQYSILWVEHTDKGRLELNFLIPNTELLTGKRLQPYYDRADRPRIDAWQTVV
NGRLGLHDPNAPENRRLLVTPSALPETKLEAAQAITRGLLALAHPGSSKRARTSQGRSQRQVLRWSAPRK
TVSALPTRTGGETSD

  Protein domains


Predicted by InterproScan.

(57-165)


  Protein structure



No available structure.




Auxiliary protein


ID   7750 GenBank   WP_310856479
Name   WP_310856479_Col440II insolico UniProt ID   _
Length   42 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 42 a.a.        Molecular weight: 4689.25 Da        Isoelectric Point: 7.0067

>WP_310856479.1 MbeB family mobilization protein [Enterobacter hormaechei]
MSSLLALAKDLEQQSKAQQQSTGEMLKAAFSEHEQSVRQTRP

  Protein domains


Predicted by InterproScan.

(1-39)


  Protein structure



No available structure.



ID   7751 GenBank   WP_042863636
Name   WP_042863636_Col440II insolico UniProt ID   _
Length   106 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 106 a.a.        Molecular weight: 11738.51 Da        Isoelectric Point: 8.5732

>WP_042863636.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Gammaproteobacteria]
MLTMWVTEDEHRRLLERCDGRQLAAWMRQTCLDEKPARAGRLPSISPALLRQLAGMGNNLNQIARKVNAG
GAGHDRVQIVAALMAIDAGLERLRHAVLEKGGDDDR

  Protein domains


Predicted by InterproScan.

(50-93)


  Protein structure



No available structure.




Host bacterium


ID   22551 GenBank   NZ_JAPZPX010000073
Plasmid name   Col440II Incompatibility group   Col440II
Plasmid size   1730 bp Coordinate of oriT [Strand]   1220..1277 [+]
Host baterium   Enterobacter hormaechei subsp. xiangfangensis strain CNCI 200

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -