Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 122058 |
| Name | oriT_JM03|p2 |
| Organism | Pseudomonas aeruginosa strain JM03 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_WTXR01000014 (61501..61818 [+], 318 nt) |
| oriT length | 318 nt |
| IRs (inverted repeats) | 199..206, 215..222 (TAAAAGGC..GCCTTTTA) 197..202, 207..212 (TTTAAA..TTTAAA) 34..39, 41..46 (GGAACG..CGTTCC) |
| Location of nic site | 307..308 |
| Conserved sequence flanking the nic site |
ATGCGGATTC |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 318 nt
>oriT_JM03|p2
CCATGGCCGAGCGGTCGTTCCTGCGCCAGCGCAGGAACGTCGTTCCCGCGCCAGTGGTCTGCTGGGCCAGTTCCACGGGCAGCAGATGGAAGGGATGCCCACCGGCCTGTTGCAGCACTTGTCGCTGCGCCAGGCCGATCAACTCGTCGCGCATGGCGAAGCACTGGCTGGCCCAGGCCTCCAAGTCCCCTTTACCTTTAAAAGGCTTTAAAAGGCCTTTTAGAGAGGCCGCGTGTTCCAGGCGCATGAAGGCTCCCTGTTGCAGGCCCCGGAAGTAGCGGGTCGGCTGGTTCAGATCGCTCATGCGGATTCGTCCTC
CCATGGCCGAGCGGTCGTTCCTGCGCCAGCGCAGGAACGTCGTTCCCGCGCCAGTGGTCTGCTGGGCCAGTTCCACGGGCAGCAGATGGAAGGGATGCCCACCGGCCTGTTGCAGCACTTGTCGCTGCGCCAGGCCGATCAACTCGTCGCGCATGGCGAAGCACTGGCTGGCCCAGGCCTCCAAGTCCCCTTTACCTTTAAAAGGCTTTAAAAGGCCTTTTAGAGAGGCCGCGTGTTCCAGGCGCATGAAGGCTCCCTGTTGCAGGCCCCGGAAGTAGCGGGTCGGCTGGTTCAGATCGCTCATGCGGATTCGTCCTC
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 16313 | GenBank | WP_003050282 |
| Name | traD_GOY11_RS07075_JM03|p2 |
UniProt ID | _ |
| Length | 730 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 730 a.a. Molecular weight: 80744.38 Da Isoelectric Point: 6.8324
>WP_003050282.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Pseudomonadota]
MSGKQPVEVLLRPAVELYTIAACAGAAFLCLVAPWSLALSPSMGVGSALAFGAYGAIRYRDARVILRYRH
NIRRLPRYVMTSKDVPVSQQRLFVGRGFLWEQKHTHRLMQTYRPEFRRYVEPTPAYRLARRLEERLEFAP
FPLSRLPALTGWDVPFNPVRPLPPVGGLPRLHGIEPDEVDVSLPLGERVGHSLVLGTTRVGKTRLAELFV
TQDIRRKNAAGEHEVVIVIDPKGDADLLKRMYAEAQRAGREGEFYVFHLGWPDISARYNAVGRFGRISEV
ATRVAGQLSGEGNSAAFREFAWRFVNIIARALVELGQRPDYMLIQRHVINIDALFIEYAQHYFAKTEPKA
WEVIVQIEAKLNEKNIPRNMIGREKRVVALEQYLSQARNYDPVLDGLRSAVRYDKTYFDKIVASLLPLLE
KLTSGKISQLLAPNYSDLADPRPIFDWMQVIRKRAVVYVGLDALSDAEVAAAVGNSMFSDLVSVAGHIYK
HGIDDGLPGATAGARVPINVHADEFNELMGDEFIPLINKGGGAGLQVTAYTQTLSDIEARIGNRAKAGQV
IGNFNNLFMLRVRETATAELLTRQLPKVEVYTTTIVSGATDSSDIRGATDFTSNTQDRISMSSVPMIEPS
HVVGLPKGQCFALLQGGQLWKVRMPLPAPDPDEVMPADLQQLAGYMRQSYSEATQWWEFTSSPALQDAAL
PDDLLDDAAAAEPDAVATGADDGAGNEAVP
MSGKQPVEVLLRPAVELYTIAACAGAAFLCLVAPWSLALSPSMGVGSALAFGAYGAIRYRDARVILRYRH
NIRRLPRYVMTSKDVPVSQQRLFVGRGFLWEQKHTHRLMQTYRPEFRRYVEPTPAYRLARRLEERLEFAP
FPLSRLPALTGWDVPFNPVRPLPPVGGLPRLHGIEPDEVDVSLPLGERVGHSLVLGTTRVGKTRLAELFV
TQDIRRKNAAGEHEVVIVIDPKGDADLLKRMYAEAQRAGREGEFYVFHLGWPDISARYNAVGRFGRISEV
ATRVAGQLSGEGNSAAFREFAWRFVNIIARALVELGQRPDYMLIQRHVINIDALFIEYAQHYFAKTEPKA
WEVIVQIEAKLNEKNIPRNMIGREKRVVALEQYLSQARNYDPVLDGLRSAVRYDKTYFDKIVASLLPLLE
KLTSGKISQLLAPNYSDLADPRPIFDWMQVIRKRAVVYVGLDALSDAEVAAAVGNSMFSDLVSVAGHIYK
HGIDDGLPGATAGARVPINVHADEFNELMGDEFIPLINKGGGAGLQVTAYTQTLSDIEARIGNRAKAGQV
IGNFNNLFMLRVRETATAELLTRQLPKVEVYTTTIVSGATDSSDIRGATDFTSNTQDRISMSSVPMIEPS
HVVGLPKGQCFALLQGGQLWKVRMPLPAPDPDEVMPADLQQLAGYMRQSYSEATQWWEFTSSPALQDAAL
PDDLLDDAAAAEPDAVATGADDGAGNEAVP
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 10118..37667
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GOY11_RS06915 (GOY11_06930) | 5156..5335 | + | 180 | Protein_10 | transposase | - |
| GOY11_RS06920 (GOY11_06935) | 5362..5669 | + | 308 | Protein_11 | TetR/AcrR family transcriptional regulator | - |
| GOY11_RS06925 (GOY11_06940) | 5685..6167 | + | 483 | WP_051084430 | AAA family ATPase | - |
| GOY11_RS06930 (GOY11_06945) | 6218..8080 | - | 1863 | WP_003050081 | MobH family relaxase | - |
| GOY11_RS06935 (GOY11_06950) | 8396..9022 | + | 627 | WP_003050085 | hypothetical protein | - |
| GOY11_RS06940 (GOY11_06955) | 9035..9667 | + | 633 | WP_003050087 | RES family NAD+ phosphorylase | - |
| GOY11_RS06945 (GOY11_06960) | 9752..10111 | + | 360 | WP_128457276 | DUF3742 family protein | - |
| GOY11_RS06950 (GOY11_06965) | 10118..11641 | - | 1524 | WP_003050092 | conjugal transfer protein TraG N-terminal domain-containing protein | tfc19 |
| GOY11_RS06955 (GOY11_06970) | 11657..12004 | - | 348 | WP_003050094 | hypothetical protein | tfc18 |
| GOY11_RS06960 (GOY11_06975) | 12001..13395 | - | 1395 | WP_003050095 | integrating conjugative element protein | tfc22 |
| GOY11_RS06965 (GOY11_06980) | 13406..14353 | - | 948 | WP_003050097 | TIGR03756 family integrating conjugative element protein | tfc23 |
| GOY11_RS06970 (GOY11_06985) | 14350..14796 | - | 447 | WP_003050101 | TIGR03757 family integrating conjugative element protein | tfc24 |
| GOY11_RS06975 (GOY11_06990) | 14960..15454 | - | 495 | WP_003050103 | JAB domain-containing protein | - |
| GOY11_RS06980 (GOY11_06995) | 15631..16395 | - | 765 | WP_003050104 | thioredoxin domain-containing protein | - |
| GOY11_RS06985 (GOY11_07000) | 16420..19302 | - | 2883 | WP_003050106 | conjugative transfer ATPase | virb4 |
| GOY11_RS06990 (GOY11_07005) | 19302..19751 | - | 450 | WP_003050109 | TIGR03751 family conjugal transfer lipoprotein | tfc15 |
| GOY11_RS06995 (GOY11_07010) | 19732..21150 | - | 1419 | WP_044396503 | TIGR03752 family integrating conjugative element protein | tfc14 |
| GOY11_RS07000 (GOY11_07015) | 21140..22051 | - | 912 | WP_003050114 | TIGR03749 family integrating conjugative element protein | tfc13 |
| GOY11_RS07005 (GOY11_07020) | 22048..22740 | - | 693 | WP_003050116 | PFL_4703 family integrating conjugative element protein | tfc12 |
| GOY11_RS07010 (GOY11_07025) | 22737..23135 | - | 399 | WP_003050133 | TIGR03750 family conjugal transfer protein | tfc11 |
| GOY11_RS07015 (GOY11_07030) | 23147..23506 | - | 360 | WP_020307818 | TIGR03745 family integrating conjugative element membrane protein | tfc10 |
| GOY11_RS07020 (GOY11_07035) | 23523..23756 | - | 234 | WP_003050225 | TIGR03758 family integrating conjugative element protein | tfc9 |
| GOY11_RS07025 (GOY11_07040) | 23753..24136 | - | 384 | WP_003050229 | RAQPRD family integrative conjugative element protein | tfc8 |
| GOY11_RS07030 (GOY11_07045) | 24340..24810 | + | 471 | WP_003050245 | helix-turn-helix domain-containing protein | - |
| GOY11_RS07035 (GOY11_07050) | 24807..25382 | + | 576 | WP_003050248 | PIN domain-containing protein | - |
| GOY11_RS07040 (GOY11_07055) | 25400..26314 | + | 915 | WP_003050256 | AAA family ATPase | - |
| GOY11_RS07045 (GOY11_07060) | 26311..26781 | + | 471 | WP_003050260 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
| GOY11_RS07050 (GOY11_07065) | 26778..27278 | + | 501 | WP_003050262 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
| GOY11_RS07055 (GOY11_07070) | 27278..28180 | + | 903 | WP_003050264 | CBASS oligonucleotide cyclase | - |
| GOY11_RS07060 (GOY11_07075) | 28217..28942 | + | 726 | WP_003050273 | CBASS effector endonuclease NucC | - |
| GOY11_RS07065 (GOY11_07080) | 28952..31576 | + | 2625 | WP_003050276 | ATP-binding protein | - |
| GOY11_RS07070 (GOY11_07085) | 31617..32366 | - | 750 | WP_003050279 | TIGR03747 family integrating conjugative element membrane protein | tfc7 |
| GOY11_RS07075 (GOY11_07090) | 32363..34555 | - | 2193 | WP_003050282 | type IV conjugative transfer system coupling protein TraD | - |
| GOY11_RS07080 (GOY11_07095) | 34560..35108 | - | 549 | WP_003050285 | integrating conjugative element protein | tfc5 |
| GOY11_RS07085 (GOY11_07100) | 35105..35695 | - | 591 | WP_003109780 | transglycosylase SLT domain-containing protein | virB1 |
| GOY11_RS07090 (GOY11_07105) | 35677..36414 | - | 738 | WP_003050292 | TIGR03759 family integrating conjugative element protein | tfc3 |
| GOY11_RS07095 (GOY11_07110) | 36427..37071 | - | 645 | WP_003050295 | hypothetical protein | - |
| GOY11_RS07100 (GOY11_07115) | 37068..37667 | - | 600 | WP_020307822 | PilL N-terminal domain-containing protein | tfc2 |
| GOY11_RS07105 (GOY11_07120) | 37890..39677 | + | 1788 | WP_003050299 | ATP-dependent endonuclease | - |
| GOY11_RS07110 (GOY11_07125) | 39661..41478 | + | 1818 | WP_023656982 | ATP-dependent helicase | - |
| GOY11_RS07115 (GOY11_07130) | 41736..42317 | - | 582 | WP_241661599 | competence protein CoiA | - |
Host bacterium
| ID | 22485 | GenBank | NZ_WTXR01000014 |
| Plasmid name | JM03|p2 | Incompatibility group | - |
| Plasmid size | 88165 bp | Coordinate of oriT [Strand] | 61501..61818 [+] |
| Host baterium | Pseudomonas aeruginosa strain JM03 |
Cargo genes
| Drug resistance gene | catB3 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | dcl |
| Symbiosis gene | - |
| Anti-CRISPR | - |