Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   121759
Name   oriT_pESC2 in_silico
Organism   Enterococcus faecalis strain ESC1
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP115994 (86695..86734 [-], 40 nt)
oriT length   40 nt
IRs (inverted repeats)      2..8, 12..18  (ACTTTAC..GTAAAGT)
Location of nic site      26..27
Conserved sequence flanking the
  nic site    		  GTGTGTTATA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 40 nt

>oriT_pESC2
CACTTTACGAAGTAAAGTATAGTGTGTTATACTTTACATG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   16040 GenBank   WP_086321360
Name   t4cp2_PE069_RS15110_pESC2 insolico UniProt ID   _
Length   752 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 752 a.a.        Molecular weight: 85966.37 Da        Isoelectric Point: 5.8623

>WP_086321360.1 TraM recognition domain-containing protein [Enterococcus faecalis]
MQGNNLFNNGLLQPKKPPIGQEQQKMTRYHQLRLVFGLVGVLLYPFAILGSIPLLIGLAVDKRDKAANVF
DMDYESFLKRNSIVFLSFSAVLLVINVFAFILWIPRGYLSAYLLFPLNLLHTALRFNWETIVALLIGSSG
MGAIFLAFSSFVAKRKVISKEDERKKITESKAYKDREKNKFEESQRFTDEQEEAYEEAVETVDIDKYKEL
SNQLLLGTSEFGLPYIINFSEFNQHVLVPATTGSGKTTLLQLLVQHAVKFNFPVILIDGKGARDTLESMR
EIAKFYDKEVHAFTDDGDMRYNPVEHGNDISIRDKLVSLAETESVFYSGAAKALLQVTIQLLDEFKGAKV
TLSGDTRTTETVERSLPFVQRFLLPRNVLHLFADAILPNNPKLFEIEVEKKIQQPKKKSVKEGSEIPPDS
DLDKEEKEEDSQIKNSKFRNISQLGIAQKETETIVLNPETLDLDSYYLLLKRNLRYLPTDKETGENIKQK
LFERLFIRYEHKDSPFYLYATSEALQTNINMLLDSELGKLFDTKNAKNVLDVQEIVNQRKLVYVSFNGLI
YKEYIRTLAQMLVGDVNYFASEMYRKNVKREVLVIFDEPASYLNETFIDMVNKGRGAGVYGIFTPQTMAD
IAKLGDKLMEQLVGNVNTLFIGKTNEKGEAEYWSETMGTYQDIDVTSVTEQEDGYSDVGKSDWSGDRGTK
RNVDRFKISPNKIKELRTGEFIIYRTAENVNLPPQKVYVRNALEWLQKSNSK

  Protein domains


Predicted by InterproScan.

TraM recognition site of TraD and TraG (TraG-D_C)

(592-691)

Helicase HerA, central domain (DUF87)

(222-424)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 128798..141706

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PE069_RS15080 (PE069_15080) 123854..125188 - 1335 WP_001036756 PcfJ domain-containing protein -
PE069_RS15085 (PE069_15085) 125185..125961 - 777 WP_000347505 Cas9 inhibitor AcrIIA9 family protein -
PE069_RS15090 (PE069_15090) 126123..126389 - 267 WP_001245899 hypothetical protein -
PE069_RS15095 (PE069_15095) 126396..126578 - 183 WP_001808764 hypothetical protein -
PE069_RS15100 (PE069_15100) 126996..127484 - 489 WP_086321361 hypothetical protein -
PE069_RS15105 (PE069_15105) 127490..128275 - 786 WP_002360778 replication-relaxation family protein -
PE069_RS15110 (PE069_15110) 128798..131056 - 2259 WP_086321360 type IV secretory system conjugative DNA transfer family protein virb4
PE069_RS15115 (PE069_15115) 131043..133388 - 2346 WP_010831073 CD3337/EF1877 family mobilome membrane protein orf15
PE069_RS15120 (PE069_15120) 133406..133801 - 396 WP_002383639 hypothetical protein -
PE069_RS15125 (PE069_15125) 133758..136250 - 2493 WP_010773420 ATP-binding protein virb4
PE069_RS15130 (PE069_15130) 136355..136813 - 459 WP_002365911 single-stranded DNA-binding protein -
PE069_RS15135 (PE069_15135) 136906..137388 - 483 WP_002360790 hypothetical protein -
PE069_RS15140 (PE069_15140) 137420..137809 - 390 WP_002360791 TcpE family conjugal transfer membrane protein orf17b
PE069_RS15145 (PE069_15145) 137809..138069 - 261 WP_010706916 hypothetical protein -
PE069_RS15150 (PE069_15150) 138074..139108 - 1035 WP_002403100 conjugal transfer protein orf13
PE069_RS15155 (PE069_15155) 139101..139415 - 315 WP_002360796 hypothetical protein -
PE069_RS15160 (PE069_15160) 139415..139831 - 417 WP_002406548 thioredoxin domain-containing protein -
PE069_RS15165 (PE069_15165) 139815..140432 - 618 WP_086321359 hypothetical protein -
PE069_RS15170 (PE069_15170) 140435..141706 - 1272 WP_010773576 CHAP domain-containing protein trsG

Host bacterium

ID   22186 GenBank   NZ_CP115994
Plasmid name   pESC2 Incompatibility group   -
Plasmid size   141731 bp Coordinate of oriT [Strand]   86695..86734 [-]
Host baterium   Enterococcus faecalis strain ESC1

Cargo genes

Drug resistance gene   erm(A), optrA, fexA, cat, tet(L), tet(M), dfrG, aph(3')-III, erm(B)
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA21, AcrIIA9