Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   121661
Name   oriT_pSchITTGS70a in_silico
Organism   Sinorhizobium chiapasense strain ITTG S70
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP133149 (33461..33517 [-], 57 nt)
oriT length   57 nt
IRs (inverted repeats)      4..9, 23..28  (GGAAAA..TTTTCC)
Location of nic site      36..37
Conserved sequence flanking the
  nic site    		  TCCTGCCTCT
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 57 nt

>oriT_pSchITTGS70a
GCAGGAAAAGGGCGTAGCACATTTTTCCGTATCCTGCCTCTCCAAATAGTAAGGGGA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   15969 GenBank   WP_331375200
Name   t4cp2_RB548_RS21015_pSchITTGS70a insolico UniProt ID   _
Length   697 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 697 a.a.        Molecular weight: 77766.71 Da        Isoelectric Point: 9.6916

>WP_331375200.1 type IV secretory system conjugative DNA transfer family protein [Sinorhizobium chiapasense]
MTKQLQAFYLLFCVGIAFVVWMLGYGLGLQLFYKDGRILETTITSNPFAPIQQFWHYKTSPALQKVALGS
MVPALLVAGLVAYIGLKPTSSPLGDAAFQDMASLRRAKWFRKQGHIFGRVGRNILRTKDDRHHLIIGPTR
SGKGAGYVIPNALMHEGSMIVTDLKGEVFKATAGYRRQNGSQVFLFAPGSEKTNSYNPLDFIRPERGNRT
TDIQNIASILVPENTESENSVWQATAQQVLAGVISYITESPFYKDRRNLAEVNSFFNSGVDLQALMKYIK
EKEPYLSKFTVESFNSYIALSERAAASALLDIQKAMRPFKNERIVAATNVTDMDLRAMKRRPISIYLAPN
ITDITLLRPLLTLFVQQVMDILTLEHDPNSLPVYFLLDEFRQLKRMDEIMTKLPYVAGYNIKLAFIIQDL
KNLDEIYGETSRHSLLGNCGYQLVLGANDQATAEYASRALGKRTIRYQSESRTIELMGLPRRTKVEQIRE
RDLMMPQEVRQMPENKMILLIEGQRPIFGEKLRFFQTQPFKSAEAFSQANIPQVPEVDYLSPKPVPATTP
EYAKGRYPSVEIPSPAPVTEEKPLTAAAAEAAPVKAEPAADEKAAAPAKRTVNKKALRPKHKAANTGGAE
ASASLDAMEARIKAIEEGLKPKAAQLKEVVETTAEKLGDKSPTKRRNIMDIFSTTVPDPVEVDVPAE

  Protein domains


Predicted by InterproScan.

Type IV secretory system Conjugative DNA transfer (T4SS-DNA_transf)

(107-533)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 87013..96935

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RB548_RS21005 (RB548_21005) 82262..82807 + 546 WP_331375199 hypothetical protein -
RB548_RS21010 (RB548_21010) 83105..84661 + 1557 WP_331375207 DUF1254 domain-containing protein -
RB548_RS21015 (RB548_21015) 84923..87016 - 2094 WP_331375200 type IV secretory system conjugative DNA transfer family protein -
RB548_RS21020 (RB548_21020) 87013..88041 - 1029 WP_331375201 P-type DNA transfer ATPase VirB11 virB11
RB548_RS21025 (RB548_21025) 88022..89233 - 1212 WP_331375058 type IV secretion system protein VirB10 virB10
RB548_RS21030 (RB548_21030) 89233..90042 - 810 WP_331375059 P-type conjugative transfer protein VirB9 virB9
RB548_RS21035 (RB548_21035) 90039..90734 - 696 WP_331375060 type IV secretion system protein virB8
RB548_RS21040 (RB548_21040) 90773..91801 - 1029 WP_331375061 type IV secretion system protein virB6
RB548_RS21045 (RB548_21045) 91817..92044 - 228 WP_331375062 hypothetical protein -
RB548_RS21050 (RB548_21050) 92034..92735 - 702 WP_331375063 type IV secretion system protein -
RB548_RS21055 (RB548_21055) 92747..93835 - 1089 WP_331375064 lytic transglycosylase domain-containing protein -
RB548_RS21060 (RB548_21060) 93832..96291 - 2460 WP_331375065 VirB4 family type IV secretion/conjugal transfer ATPase virb4
RB548_RS21065 (RB548_21065) 96294..96593 - 300 WP_331375066 VirB3 family type IV secretion system protein virB3
RB548_RS21070 (RB548_21070) 96597..96935 - 339 WP_015241462 TrbC/VirB2 family protein virB2
RB548_RS21075 (RB548_21075) 96947..97858 - 912 WP_331375208 lytic transglycosylase domain-containing protein -
RB548_RS21080 (RB548_21080) 98081..98689 + 609 WP_331375067 hypothetical protein -
RB548_RS21085 (RB548_21085) 98686..99219 + 534 WP_331375068 thermonuclease family protein -
RB548_RS21090 (RB548_21090) 99216..99917 + 702 WP_331375069 thermonuclease family protein -
RB548_RS21095 (RB548_21095) 99918..100322 + 405 WP_331375070 hypothetical protein -
RB548_RS21100 (RB548_21100) 100324..100917 + 594 WP_331375071 hypothetical protein -
RB548_RS21105 (RB548_21105) 100940..101356 + 417 WP_331375072 hypothetical protein -
RB548_RS21110 (RB548_21110) 101438..101773 - 336 WP_331375073 hypothetical protein -

Host bacterium

ID   22088 GenBank   NZ_CP133149
Plasmid name   pSchITTGS70a Incompatibility group   -
Plasmid size   174818 bp Coordinate of oriT [Strand]   33461..33517 [-]
Host baterium   Sinorhizobium chiapasense strain ITTG S70

Cargo genes

Drug resistance gene   -
Virulence gene   htpB
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -