Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   121564
Name   oriT_pKOX58_1 in_silico
Organism   Klebsiella michiganensis strain Kox58
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP089396 (16185..16233 [+], 49 nt)
oriT length   49 nt
IRs (inverted repeats)      6..13, 16..23  (GCAAAATT..AATTTTGC)
Location of nic site      32..33
Conserved sequence flanking the
  nic site    		  GGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 49 nt

>oriT_pKOX58_1
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein

ID   7484 GenBank   WP_032426796
Name   WP_032426796_pKOX58_1 insolico UniProt ID   _
Length   130 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 130 a.a.        Molecular weight: 15036.10 Da        Isoelectric Point: 4.5326

>WP_032426796.1 MULTISPECIES: conjugal transfer relaxosome DNA-binding protein TraM [Enterobacterales]
MGKVQAYPSDEVCEKINAIVEKRRMEGAKEKDVSFSSISTMLLELGLRVYEAQMERKESGFNQMAFNRAL
LESVVKTQFSVNKVLGIECLSPHVKDDPRWQWKGMVQNIQEDVQEVMRTFFPDEQEEADE

  Protein domains


Predicted by InterproScan.

TraM protein, DNA-binding (Tra_M)

(1-125)


  Protein structure



No available structure.




T4CP

ID   15889 GenBank   WP_064392534
Name   traD_LUW95_RS29390_pKOX58_1 insolico UniProt ID   _
Length   766 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 766 a.a.        Molecular weight: 85667.39 Da        Isoelectric Point: 4.8126

>WP_064392534.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Klebsiella]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMFRLSWQTFVNGCVYWWCTTLGPMR
EIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFVASWVLGRQGKQ
QSEDENTGGRQLSDKPKDVARQMKRDGMASDIKIGDLPILLNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLSLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDNDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIQRTLDTRVDARLSALLEAREAEGSLARALFTPDAPEPEQSDADSRTSPGQPEPESAP
VSPAPVKSASTAETLAAPPSVKASEVPQAKVTTVPLTRPVPAATITAAASATGSSAAATATTGGTEQELT
QQSAEQGQEVMPAGMNEDGEIEDMQAYDAWLADEQTQREMQRREEVNINHSHRRDEQDDIEIGGNF

  Protein domains


Predicted by InterproScan.

F sex factor protein N terminal (TraD_N)

(32-128)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(172-560)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 512..13766

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LUW95_RS28700 (LUW95_28700) 194..475 - 282 WP_064392542 hypothetical protein -
LUW95_RS28705 (LUW95_28705) 512..2386 - 1875 WP_064392546 type-F conjugative transfer system mating-pair stabilization protein TraN traN
LUW95_RS28710 (LUW95_28710) 2383..3000 - 618 WP_064392548 type-F conjugative transfer system pilin assembly protein TrbC trbC
LUW95_RS28715 (LUW95_28715) 3013..3996 - 984 WP_177342650 conjugal transfer pilus assembly protein TraU traU
LUW95_RS28720 (LUW95_28720) 4016..4642 - 627 WP_064392552 type-F conjugative transfer system protein TraW traW
LUW95_RS28725 (LUW95_28725) 4639..5040 - 402 WP_064381408 type-F conjugative transfer system protein TrbI -
LUW95_RS28730 (LUW95_28730) 5073..7712 - 2640 WP_064381374 type IV secretion system protein TraC virb4
LUW95_RS28735 (LUW95_28735) 7843..8247 - 405 WP_064174410 hypothetical protein -
LUW95_RS28740 (LUW95_28740) 8244..8468 - 225 WP_064381372 hypothetical protein -
LUW95_RS28745 (LUW95_28745) 8492..8785 - 294 WP_049071697 hypothetical protein -
LUW95_RS28750 (LUW95_28750) 8814..9218 - 405 WP_064381370 hypothetical protein -
LUW95_RS28755 (LUW95_28755) 9335..9916 - 582 WP_064381368 type IV conjugative transfer system lipoprotein TraV traV
LUW95_RS30445 9939..10076 - 138 Protein_13 conjugal transfer protein TraP -
LUW95_RS28765 (LUW95_28765) 10144..10740 - 597 WP_136404571 conjugal transfer protein TraP -
LUW95_RS28770 (LUW95_28770) 10733..12148 - 1416 WP_064381364 F-type conjugal transfer pilus assembly protein TraB traB
LUW95_RS28775 (LUW95_28775) 12148..12888 - 741 WP_064174405 type-F conjugative transfer system secretin TraK traK
LUW95_RS28780 (LUW95_28780) 12875..13441 - 567 WP_020323527 type IV conjugative transfer system protein TraE traE
LUW95_RS28785 (LUW95_28785) 13461..13766 - 306 WP_020323523 type IV conjugative transfer system protein TraL traL
LUW95_RS28790 (LUW95_28790) 13780..14145 - 366 WP_064381359 type IV conjugative transfer system pilin TraA -
LUW95_RS28795 (LUW95_28795) 14209..14373 - 165 WP_032426810 TraY domain-containing protein -
LUW95_RS28800 (LUW95_28800) 14549..15241 - 693 WP_064381358 hypothetical protein -
LUW95_RS28805 (LUW95_28805) 15479..15871 - 393 WP_032426796 conjugal transfer relaxosome DNA-binding protein TraM -
LUW95_RS28810 (LUW95_28810) 16378..16800 + 423 WP_077268549 transglycosylase SLT domain-containing protein -
LUW95_RS28815 (LUW95_28815) 16823..17365 - 543 WP_064392555 antirestriction protein -

Host bacterium

ID   21991 GenBank   NZ_CP089396
Plasmid name   pKOX58_1 Incompatibility group   IncFII
Plasmid size   136868 bp Coordinate of oriT [Strand]   16185..16233 [+]
Host baterium   Klebsiella michiganensis strain Kox58

Cargo genes

Drug resistance gene   blaSHV-12
Virulence gene   -
Metal resistance gene   silE, silS, silR, silC, silF, silB, silA, silP, pcoA, pcoB, pcoC, pcoD, pcoR, pcoS, pcoE
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -