Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   121434
Name   oriT_PP2 in_silico
Organism   Pseudomonas cerasi isolate PL963
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_LT963397 (55358..55539 [-], 182 nt)
oriT length   182 nt
IRs (inverted repeats)      82..89, 93..100  (CAAAGGGG..CCCCTTTG)
 44..49, 58..63  (AAAAAG..CTTTTT)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 182 nt

>oriT_PP2
AAATCTCGAATTCGCTAAACAGGCACGTTACCGATTGTCTACAAAAAAGAGCTTCGCCTTTTTCGTATCCAATCGACGTGCCAAAGGGGATACCCCTTTGAAACCCCGCAGAGCGGGAAAGCGTTGTTGTTGTCGTTGTTGGTTGTCGTCATTCAGGTGCCCTCAGGAGGTGATCTTGTGGC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   13512 GenBank   WP_015060673
Name   MobA_MobL_C6H34_RS28160_PP2 insolico UniProt ID   A0A0P9ZYT7
Length   144 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 144 a.a.        Molecular weight: 16134.39 Da        Isoelectric Point: 10.9207

>WP_015060673.1 MULTISPECIES: MobA/MobL family protein [Pseudomonas]
MTHPEIRFLNRRIRGRSQAKTEAETIAIFHASTKPIARSAGRSYVAAAYRSGTKLVDIRTSLVHDYTRRG
GVFSTEIMFPDGTSTERNALWNAAESAEKRKDGRTGREWIIALPAELDDGARQKLASAFGIKLANLLPFQ
MIWQ

  Protein domains


Predicted by InterproScan.

MobA/MobL family (MobA_MobL)

(45-129)


  Protein structure


Source ID Structure
AlphaFold DB A0A0P9ZYT7


T4CP

ID   15822 GenBank   WP_065348673
Name   t4cp2_C6H34_RS28335_PP2 insolico UniProt ID   _
Length   557 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 557 a.a.        Molecular weight: 61750.41 Da        Isoelectric Point: 6.4345

>WP_065348673.1 type IV secretory system conjugative DNA transfer family protein [Pseudomonas cerasi]
MGKAKSKPISPDNPQERIEEHPAILIGKHPTKDTFLASYGQTFVMLAAPPGTGKTVGVVTPNLLSYPDSV
VVNDPKFENWRDTAGFRAAAGHKVYRFSPELLETHRWNPLSALSRDPLYRLGQIRTLAGVLFVSDNPKNQ
EWYNKAANVFAAILLYLMEMEAMKLNGMKLTLPQAYEVASLGTGLGVWAQQAIEQHSTGPNALSVETLRE
LNGVFEASKNKSSGWSTTVDILRGALSMYAEKTVAWAVSDTDIDFTKLRKEKISIYFCVTGNAIKKYGPL
MNLFFTQAIQQNTDVMPEQGGHCADGTLILKYQVLFVIDEIAVMGRIEIMEMAPALTRGAGLRYIIIFQG
KDQLRSERTYGREAGNGIMQAFHIEIVYGTGNVELAKEYSTRLGNTTVRVHNQSLNRQKHEIGARGQTDS
YSEQPRPLLLPQEVSALPYGEELIFVEATKTTPAANIRARKIFWYEEPVFKERAGMPTPDVPIGDASKID
ALTVPVRTVEAKVAVADAKPMQAEQRQRWNPRDTTSKPVQVEADKAQPPEVEPDPEPAQADDTPETM

  Protein domains


Predicted by InterproScan.

Type IV secretory system Conjugative DNA transfer (T4SS-DNA_transf)

(26-477)

  Protein structure



No available structure.



ID   15823 GenBank   WP_065348621
Name   t4cp2_C6H34_RS28710_PP2 insolico UniProt ID   _
Length   550 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 550 a.a.        Molecular weight: 61523.12 Da        Isoelectric Point: 6.1471

>WP_065348621.1 type IV secretory system conjugative DNA transfer family protein [Pseudomonas cerasi]
MAKAKPQPISPDNPQERIEEHPAFLLGKHPTKDVFLASYGQQFVMLAAPPGSMKGVSAVIPNLLSYPDSM
VVNDPKFENWDVTSGFRASAGHKVYRFSPERLETHRWNPVSAISRDPLYRLGDIRTLARVLFVSDNPKNQ
EWYNKAGNVFSSILLYLMETPAMPCTLPQAYEIGSLGTGMGAWAQQIIELRSTGPNALTVETLRELNGVY
EASKNKSSGWSTTVDIVRDVLSVYAEKTVAWAVSDDDIDFAKMREEKTTVYFSVTERNLKKYGPLMNLFF
TQAIRLNSTVIPEQGGHCADGTLRYKYQLALMMDEFAIMGRMEIMETAPALTRGAGLRFFLIFQGKDQVR
AIYGETAGNAIMKAIHNEIVFAPGDIELAKEYSTRLGNTTVRVHNQSLNRQKHEVGARGQTDSYSEQPRP
LLLPQEVNELPFDKQLIFVQGNRQTEPMKILARKIIYFEEDVFKARQKMTPPPLPVGDATKIDALTVPVR
TVEAKVAVADTKPMQAEQRQRWNPKDTASNPAQVEADKAQPPEVEPDPEPAQADDTPETM

  Protein domains


Predicted by InterproScan.

Type IV secretory system Conjugative DNA transfer (T4SS-DNA_transf)

(35-468)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 68502..78895

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C6H34_RS28340 (PL963_P200060) 64152..64385 - 234 WP_053486459 hypothetical protein -
C6H34_RS28345 (PL963_P200061) 64403..64600 - 198 Protein_65 type IV secretory system conjugative DNA transfer family protein -
C6H34_RS28350 (PL963_P200062) 64600..64830 - 231 WP_065348622 hypothetical protein -
C6H34_RS28355 (PL963_P200063) 64917..67307 - 2391 WP_065348648 ATP-binding protein -
C6H34_RS28360 (PL963_P200064) 67433..67705 - 273 WP_044324439 hypothetical protein -
C6H34_RS28365 (PL963_P200065) 67752..68117 - 366 WP_004667995 hypothetical protein -
C6H34_RS28370 (PL963_P200066) 68102..68488 - 387 WP_065348624 hypothetical protein -
C6H34_RS28375 (PL963_P200067) 68502..69554 - 1053 WP_065348625 P-type DNA transfer ATPase VirB11 virB11
C6H34_RS28380 (PL963_P200069) 69564..70945 - 1382 Protein_72 TrbI/VirB10 family protein -
C6H34_RS28385 (PL963_P200070) 70932..71741 - 810 WP_065348627 TrbG/VirB9 family P-type conjugative transfer protein virB9
C6H34_RS28390 (PL963_P200071) 71731..72519 - 789 WP_065348628 virB8 family protein virB8
C6H34_RS28400 (PL963_P200073) 72927..73859 - 933 WP_065348629 type IV secretion system protein virB6
C6H34_RS28405 (PL963_P200074) 73870..74235 - 366 WP_065348652 hypothetical protein -
C6H34_RS28410 (PL963_P200075) 74268..74954 - 687 WP_057424700 P-type DNA transfer protein VirB5 -
C6H34_RS28415 (PL963_P200076) 74951..77449 - 2499 WP_232002781 VirB4 family type IV secretion system protein virb4
C6H34_RS28420 (PL963_P200077) 77352..77840 - 489 WP_060404295 VirB3 family type IV secretion system protein virB3
C6H34_RS28425 (PL963_P200078) 77853..78188 - 336 WP_020325459 hypothetical protein -
C6H34_RS28430 (PL963_P200079) 78188..78895 - 708 WP_065348654 lytic transglycosylase domain-containing protein virB1
C6H34_RS28435 (PL963_P200080) 78923..79135 - 213 WP_031599400 hypothetical protein -
C6H34_RS28440 (PL963_P200081) 79224..79757 - 534 WP_031598405 transcription termination/antitermination NusG family protein -
C6H34_RS30850 79829..79996 + 168 WP_157893872 hypothetical protein -
C6H34_RS28445 (PL963_P200082) 80000..80353 + 354 WP_003319387 helix-turn-helix domain-containing protein -
C6H34_RS28450 (PL963_P200083) 80370..80555 - 186 WP_065348634 hypothetical protein -
C6H34_RS28455 (PL963_P200084) 80611..81957 - 1347 WP_083188280 MFS transporter -
C6H34_RS28460 (PL963_P200085) 81999..83195 - 1197 WP_065348636 L-2-hydroxyglutarate oxidase -

Region 2: 134133..143469

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C6H34_RS28715 (PL963_P200138) 129725..129958 - 234 WP_044422741 hypothetical protein -
C6H34_RS28720 (PL963_P200139) 129976..130173 - 198 Protein_141 type IV secretory system conjugative DNA transfer family protein -
C6H34_RS28725 (PL963_P200140) 130173..130403 - 231 WP_065348622 hypothetical protein -
C6H34_RS28730 (PL963_P200141) 130521..132938 - 2418 WP_104685817 ATP-binding protein -
C6H34_RS28735 (PL963_P200142) 133064..133336 - 273 WP_044324439 hypothetical protein -
C6H34_RS28740 (PL963_P200143) 133383..133748 - 366 WP_004667995 hypothetical protein -
C6H34_RS28745 (PL963_P200144) 133733..134119 - 387 WP_065348624 hypothetical protein -
C6H34_RS28750 (PL963_P200145) 134133..135185 - 1053 WP_065348625 P-type DNA transfer ATPase VirB11 virB11
C6H34_RS28755 (PL963_P200146) 135195..136574 - 1380 WP_104685819 TrbI/VirB10 family protein virB10
C6H34_RS28760 (PL963_P200147) 136561..137370 - 810 WP_065348627 TrbG/VirB9 family P-type conjugative transfer protein virB9
C6H34_RS28765 (PL963_P200148) 137360..138148 - 789 WP_065348628 virB8 family protein virB8
C6H34_RS28775 (PL963_P200150) 138556..139488 - 933 WP_065348629 type IV secretion system protein virB6
C6H34_RS28780 (PL963_P200151) 139499..139864 - 366 WP_065348652 hypothetical protein -
C6H34_RS28785 (PL963_P200152) 139897..140583 - 687 WP_057424700 P-type DNA transfer protein VirB5 -
C6H34_RS28790 (PL963_P200153) 140580..143078 - 2499 WP_232002781 VirB4 family type IV secretion system protein virb4
C6H34_RS28795 (PL963_P200154) 142981..143469 - 489 WP_060404295 VirB3 family type IV secretion system protein virB3
C6H34_RS28800 (PL963_P200155) 143482..143817 - 336 WP_020325459 hypothetical protein -

Host bacterium

ID   21861 GenBank   NZ_LT963397
Plasmid name   PP2 Incompatibility group   -
Plasmid size   144075 bp Coordinate of oriT [Strand]   55358..55539 [-]
Host baterium   Pseudomonas cerasi isolate PL963

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -