Detailed information of oriT

oriT

The information of the oriT region

• oriTDB ID: 121321
• Name: oriT_pSGG1
• Organism: Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
• Sequence Completeness: -
• NCBI accession of oriT (coordinates [strand]): NC_015219 (13622..13643 [+], 22 nt)
• oriT length: 22 nt
• IRs (inverted repeats): 2..8, 13..19 (ACTTTAT..ATAAAGT)
• Location of nic site: _
• Conserved sequence flanking the nic site: _
• Note: Predicted by oriTfinder 2.0

oriT sequence

• Length: 22 nt

>oriT_pSGG1
CACTTTATGAATATAAAGTATA

oriT secondary structure

Predicted by RNAfold.

Relaxase

Relaxase_SGGBAA2069_RS11785_pSGG1

• ID: 13459
• GenBank: WP_231844618
• Name: Relaxase_SGGBAA2069_RS11785_pSGG1
• UniProt ID: _
• Length: 168 a.a.
• Note: Predicted by oriTfinder 2.0

Relaxase protein sequence

• Length: 168 a.a.
• Molecular weight: 19119.24 Da
• Isoelectric Point: 6.2691

>WP_231844618.1 relaxase/mobilization nuclease domain-containing protein [Streptococcus gallolyticus]
MPEKGKTFAGEVREETVAWSKDTYQLLKQAEQGKVKSYVQDIALAVLDCKETATSRETFIRLMNERGYGV
DWQDSHKYITYTDLAREQAGEKACKIRDNKLEKYYNMDFGKESMEHEFERNARTAEAEQSKRAASRVKPT
EPDRAGKQSAQRSVGDVELAEHTSAVNG

Protein domains

Predicted by InterproScan.

• Relaxase/Mobilisation nuclease domain (Relaxase) (28-119)

Protein structure

No available structure.

Host bacterium

• ID: 21748
• GenBank: NC_015219
• Plasmid name: pSGG1
• Incompatibility group: -
• Plasmid size: 20765 bp
• Coordinate of oriT [Strand]: 13622..13643 [+]
• Host baterium: Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069

Cargo genes

• Drug resistance gene: tet(O/W/32/O), tet(L)
• Virulence gene: -
• Metal resistance gene: -
• Degradation gene: -
• Symbiosis gene: -
• Anti-CRISPR: -