Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   121319
Name   oriT_pGXY050 in_silico
Organism   Komagataeibacter medellinensis NBRC 3288
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NC_016029 (1762..1842 [+], 81 nt)
oriT length   81 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 81 nt

>oriT_pGXY050
CCGTTAAGCACTACAGGTGCGCATAAGGTTTATGTGAAGTAGTCACGCCGTTAGCGTGGGCCTACTTCACCTGTCCTGCCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   13457 GenBank   WP_231850476
Name   Replic_Relax_GLX_RS16355_pGXY050 insolico UniProt ID   _
Length   170 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 170 a.a.        Molecular weight: 19457.37 Da        Isoelectric Point: 11.3562

>WP_231850476.1 helix-turn-helix domain-containing protein [Komagataeibacter medellinensis]
MSQTFSSQLWTLTQSRMISGKTHLVLQALASFEGPHGLFPSHEAIAARAGCSARTVIRSLEKAYLLGLVE
RTRRRVKRQGRMVSGSNLYRLVLKPLEQAKVAARHYAQQLREALARRKQRFLQTDIFTAETYSKNINQPY
PRHTKDEWLEILTRMQSGQTPQEAGYRGKT

  Protein domains



No domain identified.



  Protein structure



No available structure.




Host bacterium

ID   21746 GenBank   NC_016029
Plasmid name   pGXY050 Incompatibility group   -
Plasmid size   4615 bp Coordinate of oriT [Strand]   1762..1842 [+]
Host baterium   Komagataeibacter medellinensis NBRC 3288

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -