Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   121202
Name   oriT_p34978-139.941kb in_silico
Organism   Enterobacter hormaechei subsp. xiangfangensis strain 34978
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP010363 (112596..112644 [-], 49 nt)
oriT length   49 nt
IRs (inverted repeats)      6..13, 16..23  (GCAAAATT..AATTTTGC)
Location of nic site      32..33
Conserved sequence flanking the
  nic site    		  GGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 49 nt

>oriT_p34978-139.941kb
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein

ID   7404 GenBank   WP_022644939
Name   WP_022644939_p34978-139.941kb insolico UniProt ID   W8QGP1
Length   130 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 130 a.a.        Molecular weight: 15048.16 Da        Isoelectric Point: 4.5248

>WP_022644939.1 MULTISPECIES: conjugal transfer relaxosome DNA-binding protein TraM [Enterobacteriaceae]
MAKVQAYVSDEVAEKINAIVEKRRVEGAKDKDVSFSSISTMLLELGLRVYEAQMERKESGFNQMAFNKAL
LEYVVKTQFSVNKVLGIECLSPHVKDDPRWQWKGMVQNIQEDVQEVMLRFFPDEDNEVEE

  Protein domains


Predicted by InterproScan.

TraM protein, DNA-binding (Tra_M)

(1-125)


  Protein structure


Source ID Structure
AlphaFold DB W8QGP1


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 115021..136168

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LI63_RS00635 (LI63_00740) 110244..110591 + 348 WP_022644944 hypothetical protein -
LI63_RS00640 (LI63_00745) 110684..110830 + 147 WP_022644943 hypothetical protein -
LI63_RS27125 110878..111114 + 237 Protein_136 SAM-dependent DNA methyltransferase -
LI63_RS00650 (LI63_00755) 111463..112005 + 543 WP_022644941 antirestriction protein -
LI63_RS00655 (LI63_00760) 112029..112451 - 423 WP_072205880 transglycosylase SLT domain-containing protein -
LI63_RS00660 (LI63_00765) 112957..113349 + 393 WP_022644939 conjugal transfer relaxosome DNA-binding protein TraM -
LI63_RS00665 (LI63_00770) 113584..114285 + 702 WP_022644938 hypothetical protein -
LI63_RS25305 114370..114570 + 201 WP_032072063 TraY domain-containing protein -
LI63_RS00670 (LI63_00780) 114639..115007 + 369 WP_004194426 type IV conjugative transfer system pilin TraA -
LI63_RS00675 (LI63_00785) 115021..115326 + 306 WP_004144424 type IV conjugative transfer system protein TraL traL
LI63_RS00680 (LI63_00790) 115346..115912 + 567 WP_004144423 type IV conjugative transfer system protein TraE traE
LI63_RS00685 (LI63_00795) 115899..116639 + 741 WP_004152497 type-F conjugative transfer system secretin TraK traK
LI63_RS00690 (LI63_00800) 116639..118063 + 1425 WP_022644937 F-type conjugal transfer pilus assembly protein TraB traB
LI63_RS00695 (LI63_00805) 118177..118761 + 585 WP_004161368 type IV conjugative transfer system lipoprotein TraV traV
LI63_RS00700 (LI63_00810) 118893..119303 + 411 WP_004152499 hypothetical protein -
LI63_RS00705 (LI63_00815) 119409..119627 + 219 WP_004152501 hypothetical protein -
LI63_RS00710 (LI63_00820) 119628..119939 + 312 WP_004152502 hypothetical protein -
LI63_RS00715 (LI63_00825) 120006..120410 + 405 WP_004152503 hypothetical protein -
LI63_RS00720 (LI63_00830) 120453..120842 + 390 WP_004153076 hypothetical protein -
LI63_RS00725 (LI63_00835) 120850..121248 + 399 WP_011977783 hypothetical protein -
LI63_RS00730 (LI63_00840) 121320..123959 + 2640 WP_022644936 type IV secretion system protein TraC virb4
LI63_RS00735 (LI63_00845) 123959..124351 + 393 WP_022644935 type-F conjugative transfer system protein TrbI -
LI63_RS00740 (LI63_00850) 124348..124983 + 636 WP_020325113 type-F conjugative transfer system protein TraW traW
LI63_RS00745 (LI63_00855) 125018..125419 + 402 WP_022644934 hypothetical protein -
LI63_RS00750 (LI63_00860) 125416..126405 + 990 WP_015632509 conjugal transfer pilus assembly protein TraU traU
LI63_RS00755 (LI63_00865) 126418..127056 + 639 WP_022644933 type-F conjugative transfer system pilin assembly protein TrbC trbC
LI63_RS00760 (LI63_00870) 127115..129070 + 1956 WP_022644932 type-F conjugative transfer system mating-pair stabilization protein TraN traN
LI63_RS00765 (LI63_00875) 129102..129356 + 255 WP_004152674 conjugal transfer protein TrbE -
LI63_RS00770 (LI63_00880) 129334..129582 + 249 WP_022644931 hypothetical protein -
LI63_RS00775 (LI63_00885) 129595..129921 + 327 WP_004152676 hypothetical protein -
LI63_RS00780 (LI63_00890) 129942..130694 + 753 WP_004152677 type-F conjugative transfer system pilin assembly protein TraF traF
LI63_RS00785 (LI63_00895) 130705..130944 + 240 WP_004144400 type-F conjugative transfer system pilin chaperone TraQ -
LI63_RS00790 (LI63_00900) 130916..131473 + 558 WP_022644930 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
LI63_RS00795 (LI63_00905) 131519..131962 + 444 WP_004194305 F-type conjugal transfer protein TrbF -
LI63_RS00800 (LI63_00910) 131940..133319 + 1380 WP_075995129 conjugal transfer pilus assembly protein TraH traH
LI63_RS00805 (LI63_00915) 133319..136168 + 2850 WP_004152624 conjugal transfer mating-pair stabilization protein TraG traG
LI63_RS00810 (LI63_00920) 136181..136729 + 549 WP_004152623 conjugal transfer entry exclusion protein TraS -
LI63_RS00815 (LI63_00925) 136913..137644 + 732 WP_004152622 conjugal transfer complement resistance protein TraT -
LI63_RS26865 137836..138525 + 690 WP_022644928 hypothetical protein -

Host bacterium

ID   21630 GenBank   NZ_CP010363
Plasmid name   p34978-139.941kb Incompatibility group   -
Plasmid size   139941 bp Coordinate of oriT [Strand]   112596..112644 [-]
Host baterium   Enterobacter hormaechei subsp. xiangfangensis strain 34978

Cargo genes

Drug resistance gene   blaKPC-3, aac(6')-Ib, ant(3'')-Ia, blaOXA-9, blaTEM-1A, aph(6)-Id, aph(3'')-Ib, sul2, dfrA14
Virulence gene   -
Metal resistance gene   ncrY, ncrC, ncrB, ncrA
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -