Detailed information of oriT
oriT
The information of the oriT region
oriTDB ID | 121193 |
Name | oriT_2022CK-00564|unnamed1 |
Organism | Klebsiella variicola strain 2022CK-00564 |
Sequence Completeness | - |
NCBI accession of oriT (coordinates [strand]) | NZ_CP114165 (203222..203271 [+], 50 nt) |
oriT length | 50 nt |
IRs (inverted repeats) | 7..14, 17..24 (GCAAAATT..AATTTTGC) |
Location of nic site | 33..34 |
Conserved sequence flanking the nic site |
GGTGTGGTGA |
Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 50 nt
>oriT_2022CK-00564|unnamed1
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure fileT4CP
ID | 15677 | GenBank | WP_095835928 |
Name | traD_OIX91_RS27805_2022CK-00564|unnamed1 | UniProt ID | _ |
Length | 770 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
T4CP protein sequence
Download Length: 770 a.a. Molecular weight: 85922.99 Da Isoelectric Point: 5.1149
>WP_095835928.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Klebsiella]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADITVSPAPVKAPPTTKMPAEEPSVRSTEPSALRLTTVPLIKPKAAAAAAAAATVSSAGTPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDNVEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADITVSPAPVKAPPTTKMPAEEPSVRSTEPSALRLTTVPLIKPKAAAAAAAAATVSSAGTPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDNVEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 172830..199524
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIX91_RS27805 (OIX91_27805) | 172830..175142 | - | 2313 | WP_095835928 | type IV conjugative transfer system coupling protein TraD | virb4 |
OIX91_RS27810 (OIX91_27810) | 175502..176233 | - | 732 | WP_032415736 | conjugal transfer complement resistance protein TraT | - |
OIX91_RS27815 (OIX91_27815) | 176485..177087 | - | 603 | WP_023280878 | hypothetical protein | - |
OIX91_RS27820 (OIX91_27820) | 177221..178201 | + | 981 | WP_000019445 | IS5-like element ISKpn26 family transposase | - |
OIX91_RS27825 (OIX91_27825) | 178302..181133 | - | 2832 | WP_269136662 | conjugal transfer mating-pair stabilization protein TraG | traG |
OIX91_RS27830 (OIX91_27830) | 181133..182512 | - | 1380 | WP_011977731 | conjugal transfer pilus assembly protein TraH | traH |
OIX91_RS27835 (OIX91_27835) | 182490..182933 | - | 444 | WP_015065638 | F-type conjugal transfer protein TrbF | - |
OIX91_RS27840 (OIX91_27840) | 182978..183520 | - | 543 | WP_013054815 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
OIX91_RS27845 (OIX91_27845) | 183507..183734 | - | 228 | WP_114506536 | type-F conjugative transfer system pilin chaperone TraQ | - |
OIX91_RS27850 (OIX91_27850) | 183745..184497 | - | 753 | WP_015065637 | type-F conjugative transfer system pilin assembly protein TraF | traF |
OIX91_RS27855 (OIX91_27855) | 184518..184844 | - | 327 | WP_032436744 | hypothetical protein | - |
OIX91_RS29260 | 184890..185075 | - | 186 | WP_032436745 | hypothetical protein | - |
OIX91_RS27860 (OIX91_27860) | 185072..185308 | - | 237 | WP_032436746 | conjugal transfer protein TrbE | - |
OIX91_RS27865 (OIX91_27865) | 185340..187295 | - | 1956 | WP_023307537 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
OIX91_RS27870 (OIX91_27870) | 187354..187992 | - | 639 | WP_015065635 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
OIX91_RS27875 (OIX91_27875) | 188005..188964 | - | 960 | WP_015065634 | conjugal transfer pilus assembly protein TraU | traU |
OIX91_RS27880 (OIX91_27880) | 189008..189634 | - | 627 | WP_023307538 | type-F conjugative transfer system protein TraW | traW |
OIX91_RS27885 (OIX91_27885) | 189634..190023 | - | 390 | WP_004152591 | type-F conjugative transfer system protein TrbI | - |
OIX91_RS27890 (OIX91_27890) | 190023..192662 | - | 2640 | WP_016528865 | type IV secretion system protein TraC | virb4 |
OIX91_RS27895 (OIX91_27895) | 192734..193132 | - | 399 | WP_072158599 | hypothetical protein | - |
OIX91_RS27900 (OIX91_27900) | 193140..193430 | - | 291 | WP_023307542 | hypothetical protein | - |
OIX91_RS27905 (OIX91_27905) | 193427..193831 | - | 405 | WP_023307543 | hypothetical protein | - |
OIX91_RS27910 (OIX91_27910) | 193898..194215 | - | 318 | WP_023307544 | hypothetical protein | - |
OIX91_RS27915 (OIX91_27915) | 194216..194434 | - | 219 | WP_004171484 | hypothetical protein | - |
OIX91_RS27920 (OIX91_27920) | 194458..194748 | - | 291 | WP_032423381 | hypothetical protein | - |
OIX91_RS27925 (OIX91_27925) | 194753..195163 | - | 411 | WP_269136663 | hypothetical protein | - |
OIX91_RS27930 (OIX91_27930) | 195295..195864 | - | 570 | WP_023307547 | type IV conjugative transfer system lipoprotein TraV | traV |
OIX91_RS27935 (OIX91_27935) | 196076..196489 | - | 414 | Protein_205 | conjugal transfer pilus-stabilizing protein TraP | - |
OIX91_RS27940 (OIX91_27940) | 196482..197906 | - | 1425 | WP_023307549 | F-type conjugal transfer pilus assembly protein TraB | traB |
OIX91_RS27945 (OIX91_27945) | 197906..198646 | - | 741 | WP_004152497 | type-F conjugative transfer system secretin TraK | traK |
OIX91_RS27950 (OIX91_27950) | 198633..199199 | - | 567 | WP_004152602 | type IV conjugative transfer system protein TraE | traE |
OIX91_RS27955 (OIX91_27955) | 199219..199524 | - | 306 | WP_004178059 | type IV conjugative transfer system protein TraL | traL |
OIX91_RS27960 (OIX91_27960) | 199538..199906 | - | 369 | WP_023307550 | type IV conjugative transfer system pilin TraA | - |
OIX91_RS27965 (OIX91_27965) | 199960..200331 | - | 372 | WP_004208838 | TraY domain-containing protein | - |
OIX91_RS27970 (OIX91_27970) | 200415..201110 | - | 696 | WP_023307551 | transcriptional regulator TraJ family protein | - |
OIX91_RS27975 (OIX91_27975) | 201317..201709 | - | 393 | WP_004206766 | conjugal transfer relaxosome DNA-binding protein TraM | - |
OIX91_RS29265 | 201771..202025 | - | 255 | WP_330896428 | hypothetical protein | - |
OIX91_RS27980 (OIX91_27980) | 202007..202987 | - | 981 | WP_014386491 | IS5-like element ISKpn26 family transposase | - |
OIX91_RS27985 (OIX91_27985) | 203416..203823 | + | 408 | WP_020805750 | transglycosylase SLT domain-containing protein | - |
OIX91_RS27990 (OIX91_27990) | 203861..204391 | - | 531 | WP_015632491 | antirestriction protein | - |
Host bacterium
ID | 21621 | GenBank | NZ_CP114165 |
Plasmid name | 2022CK-00564|unnamed1 | Incompatibility group | IncFIB |
Plasmid size | 237760 bp | Coordinate of oriT [Strand] | 203222..203271 [+] |
Host baterium | Klebsiella variicola strain 2022CK-00564 |
Cargo genes
Drug resistance gene | - |
Virulence gene | - |
Metal resistance gene | silE, silS, silR, silC, silF, silB, silA, silP, pcoA, pcoB, pcoC, pcoD, pcoR, pcoS, pcoE, arsC, arsB, arsA, arsD, arsR, arsH |
Degradation gene | - |
Symbiosis gene | - |
Anti-CRISPR | AcrIE9 |