Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   121193
Name   oriT_2022CK-00564|unnamed1 in_silico
Organism   Klebsiella variicola strain 2022CK-00564
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP114165 (203222..203271 [+], 50 nt)
oriT length   50 nt
IRs (inverted repeats)      7..14, 17..24  (GCAAAATT..AATTTTGC)
Location of nic site      33..34
Conserved sequence flanking the
  nic site  
 
 GGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 50 nt

>oriT_2022CK-00564|unnamed1
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   15677 GenBank   WP_095835928
Name   traD_OIX91_RS27805_2022CK-00564|unnamed1 insolico UniProt ID   _
Length   770 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 770 a.a.        Molecular weight: 85922.99 Da        Isoelectric Point: 5.1149

>WP_095835928.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Klebsiella]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADITVSPAPVKAPPTTKMPAEEPSVRSTEPSALRLTTVPLIKPKAAAAAAAAATVSSAGTPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDNVEIGGNF

  Protein domains


Predicted by InterproScan.

(172-560)

(32-128)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 172830..199524

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OIX91_RS27805 (OIX91_27805) 172830..175142 - 2313 WP_095835928 type IV conjugative transfer system coupling protein TraD virb4
OIX91_RS27810 (OIX91_27810) 175502..176233 - 732 WP_032415736 conjugal transfer complement resistance protein TraT -
OIX91_RS27815 (OIX91_27815) 176485..177087 - 603 WP_023280878 hypothetical protein -
OIX91_RS27820 (OIX91_27820) 177221..178201 + 981 WP_000019445 IS5-like element ISKpn26 family transposase -
OIX91_RS27825 (OIX91_27825) 178302..181133 - 2832 WP_269136662 conjugal transfer mating-pair stabilization protein TraG traG
OIX91_RS27830 (OIX91_27830) 181133..182512 - 1380 WP_011977731 conjugal transfer pilus assembly protein TraH traH
OIX91_RS27835 (OIX91_27835) 182490..182933 - 444 WP_015065638 F-type conjugal transfer protein TrbF -
OIX91_RS27840 (OIX91_27840) 182978..183520 - 543 WP_013054815 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
OIX91_RS27845 (OIX91_27845) 183507..183734 - 228 WP_114506536 type-F conjugative transfer system pilin chaperone TraQ -
OIX91_RS27850 (OIX91_27850) 183745..184497 - 753 WP_015065637 type-F conjugative transfer system pilin assembly protein TraF traF
OIX91_RS27855 (OIX91_27855) 184518..184844 - 327 WP_032436744 hypothetical protein -
OIX91_RS29260 184890..185075 - 186 WP_032436745 hypothetical protein -
OIX91_RS27860 (OIX91_27860) 185072..185308 - 237 WP_032436746 conjugal transfer protein TrbE -
OIX91_RS27865 (OIX91_27865) 185340..187295 - 1956 WP_023307537 type-F conjugative transfer system mating-pair stabilization protein TraN traN
OIX91_RS27870 (OIX91_27870) 187354..187992 - 639 WP_015065635 type-F conjugative transfer system pilin assembly protein TrbC trbC
OIX91_RS27875 (OIX91_27875) 188005..188964 - 960 WP_015065634 conjugal transfer pilus assembly protein TraU traU
OIX91_RS27880 (OIX91_27880) 189008..189634 - 627 WP_023307538 type-F conjugative transfer system protein TraW traW
OIX91_RS27885 (OIX91_27885) 189634..190023 - 390 WP_004152591 type-F conjugative transfer system protein TrbI -
OIX91_RS27890 (OIX91_27890) 190023..192662 - 2640 WP_016528865 type IV secretion system protein TraC virb4
OIX91_RS27895 (OIX91_27895) 192734..193132 - 399 WP_072158599 hypothetical protein -
OIX91_RS27900 (OIX91_27900) 193140..193430 - 291 WP_023307542 hypothetical protein -
OIX91_RS27905 (OIX91_27905) 193427..193831 - 405 WP_023307543 hypothetical protein -
OIX91_RS27910 (OIX91_27910) 193898..194215 - 318 WP_023307544 hypothetical protein -
OIX91_RS27915 (OIX91_27915) 194216..194434 - 219 WP_004171484 hypothetical protein -
OIX91_RS27920 (OIX91_27920) 194458..194748 - 291 WP_032423381 hypothetical protein -
OIX91_RS27925 (OIX91_27925) 194753..195163 - 411 WP_269136663 hypothetical protein -
OIX91_RS27930 (OIX91_27930) 195295..195864 - 570 WP_023307547 type IV conjugative transfer system lipoprotein TraV traV
OIX91_RS27935 (OIX91_27935) 196076..196489 - 414 Protein_205 conjugal transfer pilus-stabilizing protein TraP -
OIX91_RS27940 (OIX91_27940) 196482..197906 - 1425 WP_023307549 F-type conjugal transfer pilus assembly protein TraB traB
OIX91_RS27945 (OIX91_27945) 197906..198646 - 741 WP_004152497 type-F conjugative transfer system secretin TraK traK
OIX91_RS27950 (OIX91_27950) 198633..199199 - 567 WP_004152602 type IV conjugative transfer system protein TraE traE
OIX91_RS27955 (OIX91_27955) 199219..199524 - 306 WP_004178059 type IV conjugative transfer system protein TraL traL
OIX91_RS27960 (OIX91_27960) 199538..199906 - 369 WP_023307550 type IV conjugative transfer system pilin TraA -
OIX91_RS27965 (OIX91_27965) 199960..200331 - 372 WP_004208838 TraY domain-containing protein -
OIX91_RS27970 (OIX91_27970) 200415..201110 - 696 WP_023307551 transcriptional regulator TraJ family protein -
OIX91_RS27975 (OIX91_27975) 201317..201709 - 393 WP_004206766 conjugal transfer relaxosome DNA-binding protein TraM -
OIX91_RS29265 201771..202025 - 255 WP_330896428 hypothetical protein -
OIX91_RS27980 (OIX91_27980) 202007..202987 - 981 WP_014386491 IS5-like element ISKpn26 family transposase -
OIX91_RS27985 (OIX91_27985) 203416..203823 + 408 WP_020805750 transglycosylase SLT domain-containing protein -
OIX91_RS27990 (OIX91_27990) 203861..204391 - 531 WP_015632491 antirestriction protein -


Host bacterium


ID   21621 GenBank   NZ_CP114165
Plasmid name   2022CK-00564|unnamed1 Incompatibility group   IncFIB
Plasmid size   237760 bp Coordinate of oriT [Strand]   203222..203271 [+]
Host baterium   Klebsiella variicola strain 2022CK-00564

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   silE, silS, silR, silC, silF, silB, silA, silP, pcoA, pcoB, pcoC, pcoD, pcoR, pcoS, pcoE, arsC, arsB, arsA, arsD, arsR, arsH
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIE9