Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   121139
Name   oriT_pRRI128_3 in_silico
Organism   Sinorhizobium meliloti strain RRI128
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP088116 (133800..133856 [-], 57 nt)
oriT length   57 nt
IRs (inverted repeats)      4..9, 23..28  (GGAAAA..TTTTCC)
Location of nic site      36..37
Conserved sequence flanking the
  nic site  
 
 TCCTGCCTCT
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 57 nt

>oriT_pRRI128_3
GCAGGAAAAGGGCGTAGCACATTTTTCCGTATCCTGCCTCTCCAAATTGTGAGGGGA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   15634 GenBank   WP_027990884
Name   t4cp2_SmelRRI128_RS32370_pRRI128_3 insolico UniProt ID   _
Length   699 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 699 a.a.        Molecular weight: 77791.84 Da        Isoelectric Point: 9.8534

>WP_027990884.1 type IV secretory system conjugative DNA transfer family protein [Sinorhizobium meliloti]
MTKQLQAFYLLFCVGIAFVVWMLGYGLGLQLFYKDGRILETTITSNPFAPIQQFWHYKTSPALQKVALGS
MVPALLVAGLVAYIGLKPTSSPLGDAAFQDMASLRRAKWFRKQGHIFGRVGRNILRTKDDRHHLIIGPTR
SGKGAGYVIPNALMHEGSMIVTDLKGEVFKATAGYRRQNGSQVFLFAPGSEKTNSYNPLEFIRPERGNRT
TDIQNIASILVPENTQSENSVWQATAQQVLAGVISYITESPFYKDRRNLAEVNSFFNSGVDLQALMKYIK
EKEPYLSKFTVESFNSYIALSERAAASALLDIQKAMRPFKNERIVAATNVTDMDLRAMKRRPISIYLAPN
ITDITLLRPLLTLFVQQVMDILTLEHDPNSLPVYFLLDEFRQLKRMDEIMTKLPYVAGYNIKLAFIIQDL
KNLDEIYGETSRHSLLGNCGYQLVLGANDQATAEYASRALGKRTIRYQSESRTIELMGLPRRTKVEQIRE
RDLMMPQEVRQMPETKMILLIEGQRPIFGEKLRFFQTQPFKSAEAFSQANIPQVPEVDYLAPKPVPATTP
EYAKGGDPSVEIPSLAPAKEEKPLTAAAAKAVPVKAERAADEKAAAPAKRTVNRQALRTNPKATAANIGG
AEASASLDAMEARIKAIEEGLKPKAAQLKEVVETKAEKLGDKSPTKRRNILDIFSATVPDPVEVGVTAE

  Protein domains


Predicted by InterproScan.

(107-533)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 140336..150258

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SmelRRI128_RS32355 (SmelRRI128_32355) 136819..137088 + 270 WP_231198685 hypothetical protein -
SmelRRI128_RS32360 (SmelRRI128_32360) 137138..137581 + 444 WP_027990885 ester cyclase -
SmelRRI128_RS32365 (SmelRRI128_32365) 137746..138148 + 403 Protein_150 GFA family protein -
SmelRRI128_RS32370 (SmelRRI128_32370) 138240..140339 - 2100 WP_027990884 type IV secretory system conjugative DNA transfer family protein -
SmelRRI128_RS32375 (SmelRRI128_32375) 140336..141364 - 1029 WP_027990883 P-type DNA transfer ATPase VirB11 virB11
SmelRRI128_RS32380 (SmelRRI128_32380) 141345..142556 - 1212 WP_027990882 type IV secretion system protein VirB10 virB10
SmelRRI128_RS32385 (SmelRRI128_32385) 142553..143365 - 813 WP_027990881 P-type conjugative transfer protein VirB9 virB9
SmelRRI128_RS32390 (SmelRRI128_32390) 143362..144057 - 696 WP_027990880 virB8 family protein virB8
SmelRRI128_RS32395 (SmelRRI128_32395) 144096..145124 - 1029 WP_027990879 type IV secretion system protein virB6
SmelRRI128_RS32400 (SmelRRI128_32400) 145140..145367 - 228 WP_015061508 hypothetical protein -
SmelRRI128_RS32405 (SmelRRI128_32405) 145357..146058 - 702 WP_027990878 type IV secretion system protein -
SmelRRI128_RS32410 (SmelRRI128_32410) 146070..147158 - 1089 WP_027990877 lytic transglycosylase domain-containing protein -
SmelRRI128_RS32415 (SmelRRI128_32415) 147155..149614 - 2460 WP_027990876 VirB4 family type IV secretion/conjugal transfer ATPase virb4
SmelRRI128_RS32420 (SmelRRI128_32420) 149617..149916 - 300 WP_020479309 type IV secretion system protein VirB3 virB3
SmelRRI128_RS32425 (SmelRRI128_32425) 149920..150258 - 339 WP_027990875 TrbC/VirB2 family protein virB2
SmelRRI128_RS32430 (SmelRRI128_32430) 150270..151181 - 912 WP_027990874 lytic transglycosylase domain-containing protein -
SmelRRI128_RS32435 (SmelRRI128_32435) 151404..152012 + 609 WP_026030756 hypothetical protein -
SmelRRI128_RS32440 (SmelRRI128_32440) 152009..152545 + 537 WP_027990873 thermonuclease family protein -
SmelRRI128_RS32445 (SmelRRI128_32445) 152542..153243 + 702 WP_027990872 thermonuclease family protein -
SmelRRI128_RS32450 (SmelRRI128_32450) 153244..153648 + 405 WP_027990871 hypothetical protein -
SmelRRI128_RS32455 (SmelRRI128_32455) 153650..154247 + 598 Protein_168 hypothetical protein -
SmelRRI128_RS32460 (SmelRRI128_32460) 154270..154686 + 417 WP_027990870 hypothetical protein -
SmelRRI128_RS32465 (SmelRRI128_32465) 154753..155088 - 336 WP_027990869 hypothetical protein -


Host bacterium


ID   21567 GenBank   NZ_CP088116
Plasmid name   pRRI128_3 Incompatibility group   -
Plasmid size   306339 bp Coordinate of oriT [Strand]   133800..133856 [-]
Host baterium   Sinorhizobium meliloti strain RRI128

Cargo genes


Drug resistance gene   -
Virulence gene   htpB
Metal resistance gene   -
Degradation gene   linJ, dxnH, LinG
Symbiosis gene   -
Anti-CRISPR   AcrIIA1