Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   121131
Name   oriT_pCpl in_silico
Organism   Sinorhizobium meliloti strain L6-AK89
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP085526 (1807..1863 [+], 57 nt)
oriT length   57 nt
IRs (inverted repeats)      4..9, 23..28  (GGAAAA..TTTTCC)
Location of nic site      36..37
Conserved sequence flanking the
  nic site    		  TCCTGCCTCT
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 57 nt

>oriT_pCpl
GCAGGAAAAGGGCGTAGCACATTTTTCCGTATCCTGCCTCTCCAAATTGTAAGGGGA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   15629 GenBank   WP_028006247
Name   t4cp2_LJD24_RS18850_pCpl insolico UniProt ID   _
Length   699 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 699 a.a.        Molecular weight: 77799.75 Da        Isoelectric Point: 9.6861

>WP_028006247.1 type IV secretory system conjugative DNA transfer family protein [Sinorhizobium meliloti]
MTKQLQAFYLLFCVGIAFVVWMLGYGLGLQLFYKDGRILETTITSNPFAPIQQFWHYKTSPALQKVALGS
LVPAMLVAGLVACIGLKPTSSPLGDAAFQDMASLRRGKWFRKQGHIFGRVGRNILRTRDDRHHLIIGPTR
SGKGAGYVIPNALMHEGSMIVTDLKGEVFKATAGYRRENGSQVFLFAPGSEKTSSYNPLDFIRPQRGNRT
TDIQNIASILVPENTASENSVWQATAQQVLAGAISYITESPFYKDRRNLAEVNSFFNSGVDLQALMKYIK
EKEPYLSKFTVESFNSYIALSERAAASALLDIQKAMRPFKNERIVAATNVTDMDLRAMKRRPISIYLAPN
ITDITLLRPLLTLFVQQVMDILTLEHDPNSLPVYFLLDEFRQLKRMDEIMTKLPYVAGYNIKLAFIIQDL
KNLDEIYGETSRHSLLGNCGYQLVLGANDQATAEYASRALGKRTIRYQSESRTIELMGLPRRTKVEQIRE
RDLMMPQEVRQMPENKMILLIEGQRPIFGEKLRFFQTQPFKSAEAFSQANIPRVPEVDYLSPKPVPATTP
EYAKGGEPSVEIPSPAIEKEEKPVAAAAIQSAAVKEEPAADDMPSTPAKRTVNRKALRPSAKATAANTGG
AEASPSLDAMEARIRAIEEGLKPKAAQLREVVEMKAEKLGDKSPTKRRNIMDIFSATVPDPVEVGVAAE

  Protein domains


Predicted by InterproScan.

Type IV secretory system Conjugative DNA transfer (T4SS-DNA_transf)

(103-533)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 329158..339081

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LJD24_RS18760 (LJD24_18760) 324327..324662 + 336 WP_013845322 hypothetical protein -
LJD24_RS18765 (LJD24_18765) 324744..325160 - 417 WP_014531084 hypothetical protein -
LJD24_RS18770 (LJD24_18770) 325184..325777 - 594 WP_026029870 hypothetical protein -
LJD24_RS18775 (LJD24_18775) 326182..326883 - 702 WP_014531082 thermonuclease family protein -
LJD24_RS18780 (LJD24_18780) 326880..327416 - 537 WP_017268587 thermonuclease family protein -
LJD24_RS18785 (LJD24_18785) 327413..328021 - 609 WP_014531080 hypothetical protein -
LJD24_RS18790 (LJD24_18790) 328244..329146 + 903 WP_028006246 lytic transglycosylase domain-containing protein -
LJD24_RS18795 (LJD24_18795) 329158..329496 + 339 WP_014531078 TrbC/VirB2 family protein virB2
LJD24_RS18800 (LJD24_18800) 329500..329799 + 300 WP_014531077 type IV secretion system protein VirB3 virB3
LJD24_RS18805 (LJD24_18805) 329802..332261 + 2460 WP_017268590 VirB4 family type IV secretion/conjugal transfer ATPase virb4
LJD24_RS18810 (LJD24_18810) 332258..333346 + 1089 WP_014531075 lytic transglycosylase domain-containing protein -
LJD24_RS18815 (LJD24_18815) 333358..334059 + 702 WP_014531074 type IV secretion system protein -
LJD24_RS18820 (LJD24_18820) 334049..334276 + 228 WP_014531073 hypothetical protein -
LJD24_RS18825 (LJD24_18825) 334292..335320 + 1029 WP_014531072 type IV secretion system protein virB6
LJD24_RS18830 (LJD24_18830) 335360..336055 + 696 WP_017266187 virB8 family protein virB8
LJD24_RS18835 (LJD24_18835) 336052..336861 + 810 WP_017266188 TrbG/VirB9 family P-type conjugative transfer protein virB9
LJD24_RS18840 (LJD24_18840) 336861..338072 + 1212 WP_014531069 type IV secretion system protein VirB10 virB10
LJD24_RS18845 (LJD24_18845) 338053..339081 + 1029 WP_014531068 P-type DNA transfer ATPase VirB11 virB11
LJD24_RS18850 (LJD24_18850) 339078..341177 + 2100 WP_028006247 type IV secretory system conjugative DNA transfer family protein -
LJD24_RS18855 (LJD24_18855) 341965..343809 + 1845 Protein_362 DUF3604 domain-containing protein -

Host bacterium

ID   21559 GenBank   NZ_CP085526
Plasmid name   pCpl Incompatibility group   -
Plasmid size   349886 bp Coordinate of oriT [Strand]   1807..1863 [+]
Host baterium   Sinorhizobium meliloti strain L6-AK89

Cargo genes

Drug resistance gene   -
Virulence gene   htpB
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -