Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   121130
Name   oriT_pWSM1115_3 in_silico
Organism   Sinorhizobium medicae WSM1115
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP088112 (62607..62663 [-], 57 nt)
oriT length   57 nt
IRs (inverted repeats)      4..9, 23..28  (GGAAAA..TTTTCC)
 6..11, 20..25  (AAAATG..CATTTT)
Location of nic site      36..37
Conserved sequence flanking the
  nic site  
 
 TCCTGCCTCT
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 57 nt

>oriT_pWSM1115_3
GCAGGAAAATGGTGTAGCACATTTTTCCGTATCCTGCCTCTCCGAATTGTAAGGGGA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   15628 GenBank   WP_018210776
Name   t4cp2_SmedWSM1115_RS33420_pWSM1115_3 insolico UniProt ID   _
Length   699 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 699 a.a.        Molecular weight: 77926.89 Da        Isoelectric Point: 9.6588

>WP_018210776.1 type IV secretory system conjugative DNA transfer family protein [Sinorhizobium medicae]
MTKQLQAFYLLFCVGIAFVVWMLGYGLGLQLFYRDGRILETTITSNPLAPIQQFWHYKTSPALQKVALGS
MLPALLAAGLVAYIGLKPTSSPLGDAAFQDMASLRRGKWFRKQGHIFGRVGRNILRTRDDRHHLIIGPTR
SGKGAGYVIPNALMHEGSMFVTDLKGEVFKATAGYRRQNGSQVFLFAPGSEQTNSYNPLDFIRPERGNRT
TDIQNIASILVPENTESENSVWQATAQQVLAGVISYIAESPFYKDRRNLAEVNSFFNSGVDLQALMKYIK
EKEPYLSKFTVESFNSYIALSERAAASALLDIQKAMRPFKNERIVAATNVTDMDLRAMKRRPISIYLAPN
ITDITLLRPLLTLFVQQVIDILTLEHDPNSLPVYFLLDEFRQLKRMDEIMTKLPYVAGYNIKLAFIIQDL
KNLDEIYGETSRHSLLGNCGYQLVLGANDQATAEYASRALGKRTIRYQSESRTIELMRLPRRTKVEQIRE
RDLMMPQEVRQMPENKMILLIEGQRPIFGEKLRFFQTQPFKSAEAFSQANIPQVPEVDYLSPKPVPATTP
EYAMGGDPSVEIPSPTPAKEGKPLTAAAAQATPVKADPAAEEKAPAPAKRTVNKKALHPKPKETAANTGS
AEISASLDAMEARIKAIEEGLKPKAALLKEVVETKAEKLDDKSPAKRRNIMDIFSATIPDPVEVGVTAE

  Protein domains


Predicted by InterproScan.

(103-533)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 83608..93521

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SmedWSM1115_RS33415 (SmedWSM1115_33415) 80484..81305 - 822 WP_018210775 alpha/beta fold hydrolase -
SmedWSM1115_RS33420 (SmedWSM1115_33420) 81512..83611 - 2100 WP_018210776 type IV secretory system conjugative DNA transfer family protein -
SmedWSM1115_RS33425 (SmedWSM1115_33425) 83608..84636 - 1029 WP_018210777 P-type DNA transfer ATPase VirB11 virB11
SmedWSM1115_RS33430 (SmedWSM1115_33430) 84617..85828 - 1212 WP_018210778 type IV secretion system protein VirB10 virB10
SmedWSM1115_RS33435 (SmedWSM1115_33435) 85828..86637 - 810 WP_018210779 P-type conjugative transfer protein VirB9 virB9
SmedWSM1115_RS33440 (SmedWSM1115_33440) 86634..87329 - 696 WP_018210780 virB8 family protein virB8
SmedWSM1115_RS33445 (SmedWSM1115_33445) 87368..88396 - 1029 WP_018210781 type IV secretion system protein virB6
SmedWSM1115_RS33450 (SmedWSM1115_33450) 88412..88639 - 228 WP_011971091 hypothetical protein -
SmedWSM1115_RS33455 (SmedWSM1115_33455) 88629..89330 - 702 WP_018210782 type IV secretion system protein -
SmedWSM1115_RS33460 (SmedWSM1115_33460) 89342..90430 - 1089 WP_018210783 lytic transglycosylase domain-containing protein -
SmedWSM1115_RS33465 (SmedWSM1115_33465) 90427..92886 - 2460 WP_018210784 VirB4 family type IV secretion/conjugal transfer ATPase virb4
SmedWSM1115_RS33470 (SmedWSM1115_33470) 92889..93188 - 300 WP_018210785 type IV secretion system protein VirB3 virB3
SmedWSM1115_RS33475 (SmedWSM1115_33475) 93192..93521 - 330 WP_018210786 TrbC/VirB2 family protein virB2
SmedWSM1115_RS33480 (SmedWSM1115_33480) 93533..94443 - 911 Protein_76 lytic transglycosylase domain-containing protein -
SmedWSM1115_RS33485 (SmedWSM1115_33485) 94666..95274 + 609 WP_018210788 hypothetical protein -
SmedWSM1115_RS33490 (SmedWSM1115_33490) 95271..95807 + 537 WP_018210789 thermonuclease family protein -
SmedWSM1115_RS33495 (SmedWSM1115_33495) 95804..96505 + 702 WP_018210790 thermonuclease family protein -
SmedWSM1115_RS33500 (SmedWSM1115_33500) 96563..96898 + 336 WP_225996853 hypothetical protein -
SmedWSM1115_RS33505 (SmedWSM1115_33505) 96910..97506 + 597 WP_018210792 hypothetical protein -
SmedWSM1115_RS33510 (SmedWSM1115_33510) 97526..97942 + 417 WP_018210793 hypothetical protein -
SmedWSM1115_RS33515 (SmedWSM1115_33515) 98025..98360 - 336 WP_026183708 hypothetical protein -


Host bacterium


ID   21558 GenBank   NZ_CP088112
Plasmid name   pWSM1115_3 Incompatibility group   -
Plasmid size   276847 bp Coordinate of oriT [Strand]   62607..62663 [-]
Host baterium   Sinorhizobium medicae WSM1115

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -