Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   120986
Name   oriT_2953647|unnamed6 in_silico
Organism   Citrobacter freundii strain 2953647
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP114570 (17208..17306 [-], 99 nt)
oriT length   99 nt
IRs (inverted repeats)      77..82, 89..94  (AAAAAA..TTTTTT)
 77..82, 88..93  (AAAAAA..TTTTTT)
 31..38, 41..48  (AGCGTGAT..ATCACGCT)
 17..23, 35..41  (TAAATCA..TGATTTA)
Location of nic site      59..60
Conserved sequence flanking the
  nic site    		  GGTGTATAGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 99 nt

>oriT_2953647|unnamed6
TTTGTTTTTTTTCTTTTAAATCAGTGCGATAGCGTGATTTATCACGCTGCGTTAGGTGTATAGCAGGTTAAGGGATAAAAAATCATCTTTTTTTGGTAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   13241 GenBank   WP_000130000
Name   Replic_Relax_O4000_RS29490_2953647|unnamed6 insolico UniProt ID   R4WML4
Length   101 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 101 a.a.        Molecular weight: 11477.11 Da        Isoelectric Point: 7.5204

>WP_000130000.1 MULTISPECIES: PadR family transcriptional regulator [Pseudomonadota]
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG

  Protein domains


Predicted by InterproScan.

Transcriptional regulator PadR-like family (PadR)

(15-84)


  Protein structure


Source ID Structure
AlphaFold DB R4WML4


Host bacterium

ID   21415 GenBank   NZ_CP114570
Plasmid name   2953647|unnamed6 Incompatibility group   IncR
Plasmid size   46143 bp Coordinate of oriT [Strand]   17208..17306 [-]
Host baterium   Citrobacter freundii strain 2953647

Cargo genes

Drug resistance gene   tet(A), aac(6')-Ib-cr, blaOXA-1, catB3, ARR-3, qacE, sul1, mph(A), aph(3')-Ia
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -