Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   120912
Name   oriT_pHRC017 in_silico
Organism   Sinorhizobium meliloti
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NC_019313 (132455..132511 [-], 57 nt)
oriT length   57 nt
IRs (inverted repeats)      4..9, 23..28  (GGAAAA..TTTTCC)
Location of nic site      36..37
Conserved sequence flanking the
  nic site  
 
 TCCTGCCTCT
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 57 nt

>oriT_pHRC017
GCAGGAAAAGGGCGTAGCACATTTTTCCGTATCCTGCCTCTCCAAATTGTGAGGGGA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   15471 GenBank   WP_015061514
Name   t4cp2_HTB76_RS01245_pHRC017 insolico UniProt ID   _
Length   699 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 699 a.a.        Molecular weight: 77736.65 Da        Isoelectric Point: 9.8074

>WP_015061514.1 type IV secretory system conjugative DNA transfer family protein [Sinorhizobium meliloti]
MTKQLQAFYLLFCVGIAFVVWMLGYGLGLQLFYKDGRILETTITSNPFAPIQQFWHYKTSPALQKVALGS
MVPALLVAGLVAYIGLKPTSSPLGDAAFQDMASLRRAKWFRKQGHIFGRVGRNILRTKDDRHHLIIGPTR
SGKGAGYVIPNALMHEGSMIVTDLKGEVFKATAGYRRQNGSQVFLFAPGSEKTNSYNPLDFIRPERGNRT
TDIQNIASILVPENTESENSVWQATAQQVLAGVISYITESPFYKDRRNLAEVNSFFNSGVDLQALMKYIK
EKEPYLSKFTVESFNSYIALSERAAASALLDIQKAMRPFKNERIVAATNVTDMDLRAMKRRPISIYLAPN
ITDITLLRPLLTLFVQQVMDILTLEHDPNSLPVYFLLDEFRQLKRMDEIMTKLPYVAGYNIKLAFIIQDL
KNLDEIYGETSRHSLLGNCGYQLVLGANDQATAEYASRALGKRTIRYQSESRTIELMGLPRRTKVEQIRE
RDLMMPQEVRQMPETKMILLIEGQRPIFGEKLRFFQTQPFKSAEAFSQANIPQVPEVDYLAPKPVPATTP
EYAKGGDPSVEIPSLAPAKEEKPLTAAAAKAVPVKAERAADEKAAAPAKRTVNRQALRTNPKATAANTGG
AEASASLDATEARIKAIEEGLKPKAAQLKEVVETKAEKLGDKSPTKRRNILDIFSATVPDPVEVGVTAE

  Protein domains


Predicted by InterproScan.

(107-533)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 224364..234285

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTB76_RS01155 219548..219878 + 331 Protein_235 hypothetical protein -
HTB76_RS01160 (pHRC017_0543) 220378..220971 - 594 WP_015061493 hypothetical protein -
HTB76_RS01165 (pHRC017_0545) 220973..221377 - 405 WP_153432028 hypothetical protein -
HTB76_RS01170 221378..222081 - 704 Protein_238 thermonuclease family protein -
HTB76_RS01175 (pHRC017_0550) 222078..222614 - 537 WP_015061497 thermonuclease family protein -
HTB76_RS01180 (pHRC017_0551) 222611..223219 - 609 WP_015061498 hypothetical protein -
HTB76_RS01185 (pHRC017_0554) 223442..224352 + 911 Protein_241 lytic transglycosylase domain-containing protein -
HTB76_RS01190 (pHRC017_0557) 224364..224702 + 339 WP_015061502 TrbC/VirB2 family protein virB2
HTB76_RS01195 (pHRC017_0558) 224706..225005 + 300 WP_014531077 type IV secretion system protein VirB3 virB3
HTB76_RS01200 (pHRC017_0559) 225008..227466 + 2459 Protein_244 VirB4 family type IV secretion/conjugal transfer ATPase -
HTB76_RS01205 (pHRC017_0562) 227463..228551 + 1089 WP_153432035 lytic transglycosylase domain-containing protein -
HTB76_RS01210 (pHRC017_0564) 228563..229264 + 702 WP_015061507 type IV secretion system protein -
HTB76_RS01215 (pHRC017_0565) 229254..229481 + 228 WP_015061508 hypothetical protein -
HTB76_RS01220 (pHRC017_0567) 229497..230525 + 1029 WP_015061509 type IV secretion system protein virB6
HTB76_RS01225 (pHRC017_0568) 230564..231259 + 696 WP_015061510 virB8 family protein virB8
HTB76_RS01230 (pHRC017_0570) 231256..232068 + 813 WP_015061511 P-type conjugative transfer protein VirB9 virB9
HTB76_RS01235 (pHRC017_0571) 232065..233276 + 1212 WP_015061512 type IV secretion system protein VirB10 virB10
HTB76_RS01240 (pHRC017_0574) 233257..234285 + 1029 WP_015061513 P-type DNA transfer ATPase VirB11 virB11
HTB76_RS01245 (pHRC017_0576) 234282..236381 + 2100 WP_015061514 type IV secretory system conjugative DNA transfer family protein -
HTB76_RS01250 (pHRC017_0578) 236581..237489 + 909 WP_015061515 tyrosine-type recombinase/integrase -
HTB76_RS01255 (pHRC017_0579) 237493..238686 + 1194 WP_015061516 IS91 family transposase -


Host bacterium


ID   21341 GenBank   NC_019313
Plasmid name   pHRC017 Incompatibility group   -
Plasmid size   298356 bp Coordinate of oriT [Strand]   132455..132511 [-]
Host baterium   Sinorhizobium meliloti

Cargo genes


Drug resistance gene   -
Virulence gene   htpB
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -