Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   120834
Name   oriT_p31A16003_B_KPC in_silico
Organism   Serratia marcescens strain 31A16CRGN003
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_OQ821181 (56771..56871 [-], 101 nt)
oriT length   101 nt
IRs (inverted repeats)      80..85, 91..96  (AAAAAA..TTTTTT)
 20..26, 38..44  (TAAATCA..TGATTTA)
Location of nic site      62..63
Conserved sequence flanking the
  nic site  
 
 GGTGTATAGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 101 nt

>oriT_p31A16003_B_KPC
TATTTATTTTTTTATCTTTTAAATCAGTATGATAGCGTGATTTATCGCGCTGCGTTAGGTGTATAGCAGGTTAAGGGATAAAAAATCATCTTTTTTGGTAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   15422 GenBank   WP_319382229
Name   t4cp2_SLH58_RS00360_p31A16003_B_KPC insolico UniProt ID   _
Length   506 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 506 a.a.        Molecular weight: 57296.36 Da        Isoelectric Point: 9.5206

>WP_319382229.1 type IV secretion system DNA-binding domain-containing protein [Serratia marcescens]
MDDRERGLAFLFAITLPPVMVWFLVAKFTYGIDPSTAKYLIPYLVKNTFSLWPLWSALIAGWFIGVGGLI
AFIIYDKSRVFKGERFKKIYRGTELVRARTLADKTRERGVNQLTVANIPIPTYAENLHFSIAGTTGTGKT
TIFNELLFKSIIRGGKNIALDPNGGFLKNFYRPGDVILNAYDKRTEGWVFFNEIRRSYDYERLVNSIVQE
SPDMATEEWFGYGRLIFSEVSKKLHSLYSTVTMEEVIHWACNVDQKKLKEFLMGTPAEAIFSGSEKAVGS
ARFVLSKNLAPHLKMPEGNFSLRDWLDDGKPGTLFITWQEEMKRSLNPLISCWLDSIFSIVLGMGEKESR
INVFIDELESLQFLPNLNDALTKGRKSGLCVYAGYQTYSQLVKVYGRDMAQTILANMRSNIVLGGSRLGD
ETLDQMSRSLGEIEGEVERKESDPQKPWIVRKRRDVKVVRAVTPTEISMLPNLTGYLALPGDMPVAKFKA
KHVMLVFRDLTSAAQM

  Protein domains


Predicted by InterproScan.

(113-489)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 12514..22839

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SLH58_RS00045 (PPEDELGO_00008) 8706..9815 + 1110 WP_000842134 S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase -
SLH58_RS00050 (PPEDELGO_00009) 9837..10259 + 423 Protein_9 alpha/beta hydrolase-fold protein -
SLH58_RS00055 (PPEDELGO_00010) 10305..11009 - 705 WP_001067855 IS6-like element IS26 family transposase -
SLH58_RS00060 (PPEDELGO_00011) 11074..11253 - 180 Protein_11 helix-turn-helix domain-containing protein -
SLH58_RS00065 11520..11807 + 288 Protein_12 DUF6710 family protein -
SLH58_RS00070 (PPEDELGO_00012) 11981..12514 - 534 WP_000792636 phospholipase D family protein -
SLH58_RS00075 (PPEDELGO_00013) 12514..13509 - 996 WP_000128596 ATPase, T2SS/T4P/T4SS family virB11
SLH58_RS00080 (PPEDELGO_00014) 13551..14711 - 1161 WP_000101710 type IV secretion system protein VirB10 virB10
SLH58_RS00085 (PPEDELGO_00015) 14711..15595 - 885 WP_000735066 TrbG/VirB9 family P-type conjugative transfer protein virB9
SLH58_RS00090 (PPEDELGO_00016) 15606..16304 - 699 WP_000646594 virB8 family protein virB8
SLH58_RS00095 16294..16452 - 159 WP_012561180 hypothetical protein -
SLH58_RS00100 (PPEDELGO_00017) 16523..17563 - 1041 WP_001749958 type IV secretion system protein virB6
SLH58_RS00105 (PPEDELGO_00018) 17579..17806 - 228 WP_001749959 IncN-type entry exclusion lipoprotein EexN -
SLH58_RS00110 (PPEDELGO_00019) 17814..18578 - 765 WP_013149461 type IV secretion system protein virB5
SLH58_RS00115 (PPEDELGO_00020) 18545..21145 - 2601 WP_001749961 VirB4 family type IV secretion/conjugal transfer ATPase virb4
SLH58_RS00120 (PPEDELGO_00021) 21145..21462 - 318 WP_000496058 VirB3 family type IV secretion system protein virB3
SLH58_RS00125 (PPEDELGO_00022) 21512..21805 - 294 WP_001749962 hypothetical protein virB2
SLH58_RS00130 (PPEDELGO_00023) 21815..22096 - 282 WP_000440698 transcriptional repressor KorA -
SLH58_RS00135 (PPEDELGO_00024) 22105..22839 - 735 WP_001749963 lytic transglycosylase domain-containing protein virB1
SLH58_RS00140 (PPEDELGO_00025) 22882..23253 + 372 WP_011867773 H-NS family nucleoid-associated regulatory protein -
SLH58_RS00145 (PPEDELGO_00026) 23269..23613 + 345 WP_001749964 hypothetical protein -
SLH58_RS00150 (PPEDELGO_00027) 23610..23924 + 315 WP_001749965 TrbM/KikA/MpfK family conjugal transfer protein -
SLH58_RS00155 (PPEDELGO_00028) 24038..24271 + 234 WP_001191790 hypothetical protein -
SLH58_RS00160 (PPEDELGO_00029) 24321..24968 + 648 WP_012561184 restriction endonuclease -
SLH58_RS00165 (PPEDELGO_00030) 24973..25179 + 207 WP_001749967 hypothetical protein -
SLH58_RS00170 (PPEDELGO_00031) 25190..25462 - 273 Protein_33 IS1 family transposase -
SLH58_RS00175 (PPEDELGO_00032) 25561..26994 + 1434 WP_001288432 DNA cytosine methyltransferase -


Host bacterium


ID   21263 GenBank   NZ_OQ821181
Plasmid name   p31A16003_B_KPC Incompatibility group   IncN
Plasmid size   87500 bp Coordinate of oriT [Strand]   56771..56871 [-]
Host baterium   Serratia marcescens strain 31A16CRGN003

Cargo genes


Drug resistance gene   blaKPC-3, tet(D), dfrA14, sul2, aph(3'')-Ib, aph(6)-Id, blaOXA-9, ant(3'')-Ia, aac(6')-Ib
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -