Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   120724
Name   oriT_RHBSTW-00484|unnamed in_silico
Organism   Klebsiella sp. RHBSTW-00484
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP055484 (34505..34554 [-], 50 nt)
oriT length   50 nt
IRs (inverted repeats)      7..14, 17..24  (GCAAAATT..AATTTTGC)
Location of nic site      33..34
Conserved sequence flanking the
  nic site    		  TGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 50 nt

>oriT_RHBSTW-00484|unnamed
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein

ID   7293 GenBank   WP_053390193
Name   WP_053390193_RHBSTW-00484|unnamed insolico UniProt ID   A0A8G2A327
Length   130 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 130 a.a.        Molecular weight: 14883.89 Da        Isoelectric Point: 4.3779

>WP_053390193.1 MULTISPECIES: conjugal transfer relaxosome DNA-binding protein TraM [Enterobacteriaceae]
MAKVQAYVSDEVADKINAIVEKRRVEGAKDKDISFSSISTMLLELGLRVYEAQMERKESGFNQMAFNKAL
LESVIKTQFTVNKVLGIECLSPHVSGNPRWEWPGLIENIRDDVQEVMLRFFPDEESEDEE

  Protein domains


Predicted by InterproScan.

TraM protein, DNA-binding (Tra_M)

(1-125)


  Protein structure



No available structure.




T4CP

ID   15336 GenBank   WP_064386203
Name   traD_HV213_RS32220_RHBSTW-00484|unnamed insolico UniProt ID   _
Length   772 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 772 a.a.        Molecular weight: 86585.38 Da        Isoelectric Point: 5.0283

>WP_064386203.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Klebsiella/Raoultella group]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFIIFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLAPMR
DIIRSQPVYTINYYGKSLEYNSEQILADKYTIWCGEQLWTSFVFAAIVSLTVCIVTFFVASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKHSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDIWRECLTLPDFDNVSNTLIPMGTKEDPFWQG
SGRTIFSEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLKNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDQPNGWLFISSNADTHASLKPVISMWLSIAIRGLLGMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDVQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIQRNLDTRVDARLNALLEAREAEGSLARTLFTPDAPAPELAEKDEKVGNPPEQSQPAE
SSGTSATVKVPSTAKTPEADESGQSPEVSNPAALLTKVVTVPLTRPRPAAATGTAAVASATDVPATPAGG
TEQALETQPAEQGQDMLPPGVNEYGEIDDMHAWDEWQSGEQTQRDMQRREEVNINHSHRRDEQDDIEIGG
NF

  Protein domains


Predicted by InterproScan.

F sex factor protein N terminal (TraD_N)

(32-128)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(172-560)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 36966..64637

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HV213_RS32040 (HV213_32030) 33373..33915 + 543 WP_053390246 antirestriction protein -
HV213_RS32045 (HV213_32035) 33938..34360 - 423 WP_077268549 transglycosylase SLT domain-containing protein -
HV213_RS32050 (HV213_32040) 34866..35258 + 393 WP_053390193 conjugal transfer relaxosome DNA-binding protein TraM -
HV213_RS32055 (HV213_32045) 35496..36197 + 702 WP_094898581 hypothetical protein -
HV213_RS32060 (HV213_32050) 36358..36519 + 162 WP_172686697 TraY domain-containing protein -
HV213_RS32065 (HV213_32055) 36584..36952 + 369 WP_064386081 type IV conjugative transfer system pilin TraA -
HV213_RS32070 (HV213_32060) 36966..37271 + 306 WP_032744112 type IV conjugative transfer system protein TraL traL
HV213_RS32075 (HV213_32065) 37290..37856 + 567 WP_064386078 type IV conjugative transfer system protein TraE traE
HV213_RS32080 (HV213_32070) 37843..38577 + 735 WP_064386077 type-F conjugative transfer system secretin TraK traK
HV213_RS32085 (HV213_32075) 38577..40001 + 1425 WP_064386076 F-type conjugal transfer pilus assembly protein TraB traB
HV213_RS32090 (HV213_32080) 40064..40633 + 570 WP_074182910 type IV conjugative transfer system lipoprotein TraV traV
HV213_RS33455 40657..41025 + 369 WP_224253886 hypothetical protein -
HV213_RS32100 (HV213_32090) 41032..41274 + 243 WP_064386074 hypothetical protein -
HV213_RS32105 (HV213_32095) 41271..41546 + 276 WP_181486541 hypothetical protein -
HV213_RS32110 (HV213_32100) 41647..42627 - 981 WP_000019450 IS5-like element ISKpn26 family transposase -
HV213_RS33665 42696..42875 + 180 Protein_61 hypothetical protein -
HV213_RS32115 (HV213_32105) 42872..43219 + 348 WP_064386070 hypothetical protein -
HV213_RS32120 (HV213_32110) 43216..43614 + 399 WP_224253887 hypothetical protein -
HV213_RS32125 (HV213_32115) 43698..46337 + 2640 WP_132468255 type IV secretion system protein TraC virb4
HV213_RS32130 (HV213_32120) 46337..46726 + 390 WP_132468254 type-F conjugative transfer system protein TrbI -
HV213_RS32135 (HV213_32125) 46723..47352 + 630 WP_132468253 type-F conjugative transfer system protein TraW traW
HV213_RS32140 (HV213_32130) 47375..48352 + 978 WP_157349379 conjugal transfer pilus assembly protein TraU traU
HV213_RS32145 (HV213_32135) 48542..49189 + 648 WP_132468252 type-F conjugative transfer system pilin assembly protein TrbC trbC
HV213_RS32150 (HV213_32140) 49566..51521 + 1956 WP_148853181 type-F conjugative transfer system mating-pair stabilization protein TraN traN
HV213_RS32155 (HV213_32145) 51537..51917 + 381 WP_142255964 hypothetical protein -
HV213_RS32160 (HV213_32150) 51907..52134 + 228 WP_148853183 conjugal transfer protein TrbE -
HV213_RS32165 (HV213_32155) 52144..52470 + 327 WP_148853185 hypothetical protein -
HV213_RS32170 (HV213_32160) 52493..53245 + 753 WP_148853187 type-F conjugative transfer system pilin assembly protein TraF traF
HV213_RS32175 (HV213_32165) 53659..54018 - 360 WP_064386183 hypothetical protein -
HV213_RS32180 (HV213_32170) 54107..54343 + 237 WP_064386186 type-F conjugative transfer system pilin chaperone TraQ -
HV213_RS32185 (HV213_32175) 54318..54884 + 567 WP_100663597 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
HV213_RS32190 (HV213_32180) 54877..55305 + 429 WP_100663598 conjugal transfer protein TrbF -
HV213_RS32195 (HV213_32185) 55292..56662 + 1371 WP_064386191 conjugal transfer pilus assembly protein TraH traH
HV213_RS32200 (HV213_32190) 56662..59541 + 2880 WP_064386194 conjugal transfer mating-pair stabilization protein TraG traG
HV213_RS32205 (HV213_32195) 59558..60226 + 669 WP_128317877 hypothetical protein -
HV213_RS32210 (HV213_32200) 60585..61316 + 732 WP_064386198 conjugal transfer complement resistance protein TraT -
HV213_RS33460 61508..62200 + 693 WP_202395549 hypothetical protein -
HV213_RS32220 (HV213_32210) 62319..64637 + 2319 WP_064386203 type IV conjugative transfer system coupling protein TraD virb4

Host bacterium

ID   21153 GenBank   NZ_CP055484
Plasmid name   RHBSTW-00484|unnamed Incompatibility group   IncFII
Plasmid size   82064 bp Coordinate of oriT [Strand]   34505..34554 [-]
Host baterium   Klebsiella sp. RHBSTW-00484

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -