Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   120699
Name   oriT_FDAARGOS_627|unnamed1 in_silico
Organism   Klebsiella variicola strain FDAARGOS_627
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP044049 (91693..91741 [+], 49 nt)
oriT length   49 nt
IRs (inverted repeats)      6..13, 16..23  (GCAAAATT..AATTTTGC)
Location of nic site      32..33
Conserved sequence flanking the
  nic site    		  GGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 49 nt

>oriT_FDAARGOS_627|unnamed1
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein

ID   7292 GenBank   WP_020805752
Name   WP_020805752_FDAARGOS_627|unnamed1 insolico UniProt ID   A0A377TIM3
Length   130 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 130 a.a.        Molecular weight: 14772.81 Da        Isoelectric Point: 4.5715

>WP_020805752.1 MULTISPECIES: conjugal transfer relaxosome DNA-binding protein TraM [Gammaproteobacteria]
MAKIQVYVNDNVAEKINAIAVQRRAEGAKEKDISYSSIASMLLELGLRVYEAQMERKESGFNQMAFNRAL
LESMVKTQFTVNKVLGIECLSPHVNGNPKWEWSGLIENIRDDVSAVMEKFFPNESEIEDE

  Protein domains


Predicted by InterproScan.

TraM protein, DNA-binding (Tra_M)

(1-125)


  Protein structure


Source ID Structure
AlphaFold DB A0A377TIM3


T4CP

ID   15319 GenBank   WP_150341758
Name   traD_FOB35_RS00305_FDAARGOS_627|unnamed1 insolico UniProt ID   _
Length   766 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 766 a.a.        Molecular weight: 85307.06 Da        Isoelectric Point: 4.9615

>WP_150341758.1 type IV conjugative transfer system coupling protein TraD [Klebsiella variicola]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFAFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPDDAGSHAGERPELASQPA
PAEVTVSPAPVKAPATTTMPAAEPSARTAEPPVLRVTTVPLIKPKAAAAASTASSAGNPAAAAGGTEQEL
AQQSAEQGQDMLPAGMNEDGVIEDTQAYDAWADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF

  Protein domains


Predicted by InterproScan.

F sex factor protein N terminal (TraD_N)

(32-128)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(172-560)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 60789..89315

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FOB35_RS00305 (FOB35_00305) 60789..63089 - 2301 WP_150341758 type IV conjugative transfer system coupling protein TraD virb4
FOB35_RS29325 63218..63907 - 690 WP_163591641 hypothetical protein -
FOB35_RS00315 (FOB35_00315) 64100..64831 - 732 WP_040172406 conjugal transfer complement resistance protein TraT -
FOB35_RS00320 (FOB35_00320) 65143..65667 - 525 WP_072040864 hypothetical protein -
FOB35_RS00325 (FOB35_00325) 65678..68521 - 2844 WP_150341759 conjugal transfer mating-pair stabilization protein TraG traG
FOB35_RS00330 (FOB35_00330) 68521..69900 - 1380 WP_072198238 conjugal transfer pilus assembly protein TraH traH
FOB35_RS00335 (FOB35_00335) 69878..70321 - 444 WP_150341760 F-type conjugal transfer protein TrbF -
FOB35_RS00340 (FOB35_00340) 70367..70924 - 558 WP_020804677 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
FOB35_RS00345 (FOB35_00345) 70896..71135 - 240 WP_009309875 type-F conjugative transfer system pilin chaperone TraQ -
FOB35_RS00350 (FOB35_00350) 71146..71898 - 753 WP_080884092 type-F conjugative transfer system pilin assembly protein TraF traF
FOB35_RS00355 (FOB35_00355) 71919..72245 - 327 WP_012539967 hypothetical protein -
FOB35_RS00360 (FOB35_00360) 72256..72483 - 228 WP_012540032 conjugal transfer protein TrbE -
FOB35_RS00365 (FOB35_00365) 72473..72754 - 282 WP_022644736 hypothetical protein -
FOB35_RS00370 (FOB35_00370) 72787..74736 - 1950 WP_150341761 type-F conjugative transfer system mating-pair stabilization protein TraN traN
FOB35_RS00375 (FOB35_00375) 74733..75116 - 384 WP_086075690 hypothetical protein -
FOB35_RS00380 (FOB35_00380) 75113..75760 - 648 WP_150341762 type-F conjugative transfer system pilin assembly protein TrbC trbC
FOB35_RS00385 (FOB35_00385) 75905..76507 - 603 WP_022631520 hypothetical protein -
FOB35_RS00390 (FOB35_00390) 76564..77253 + 690 WP_032427592 hypothetical protein -
FOB35_RS00395 (FOB35_00395) 77228..77776 - 549 WP_022631518 hypothetical protein -
FOB35_RS00400 (FOB35_00400) 77791..78750 - 960 WP_029497356 conjugal transfer pilus assembly protein TraU traU
FOB35_RS00405 (FOB35_00405) 78794..79420 - 627 WP_020314628 type-F conjugative transfer system protein TraW traW
FOB35_RS00410 (FOB35_00410) 79420..79809 - 390 WP_004167468 type-F conjugative transfer system protein TrbI -
FOB35_RS00415 (FOB35_00415) 79809..82448 - 2640 WP_020323518 type IV secretion system protein TraC virb4
FOB35_RS00420 (FOB35_00420) 82520..82918 - 399 WP_165784257 hypothetical protein -
FOB35_RS00425 (FOB35_00425) 82926..83216 - 291 WP_100676553 hypothetical protein -
FOB35_RS00430 (FOB35_00430) 83213..83617 - 405 WP_100676552 hypothetical protein -
FOB35_RS00435 (FOB35_00435) 83684..83995 - 312 WP_100676551 hypothetical protein -
FOB35_RS00440 (FOB35_00440) 83996..84214 - 219 WP_004171484 hypothetical protein -
FOB35_RS00445 (FOB35_00445) 84238..84522 - 285 WP_086075698 hypothetical protein -
FOB35_RS00450 (FOB35_00450) 84527..84937 - 411 WP_048263635 hypothetical protein -
FOB35_RS00455 (FOB35_00455) 85069..85653 - 585 WP_015632500 type IV conjugative transfer system lipoprotein TraV traV
FOB35_RS29330 85673..85828 - 156 WP_153932038 hypothetical protein -
FOB35_RS00460 (FOB35_00460) 85867..86280 - 414 Protein_86 conjugal transfer pilus-stabilizing protein TraP -
FOB35_RS00465 (FOB35_00465) 86273..87697 - 1425 WP_100676549 F-type conjugal transfer pilus assembly protein TraB traB
FOB35_RS00470 (FOB35_00470) 87697..88437 - 741 WP_064182676 type-F conjugative transfer system secretin TraK traK
FOB35_RS00475 (FOB35_00475) 88424..88990 - 567 WP_020316627 type IV conjugative transfer system protein TraE traE
FOB35_RS00480 (FOB35_00480) 89010..89315 - 306 WP_095027391 type IV conjugative transfer system protein TraL traL
FOB35_RS00485 (FOB35_00485) 89329..89697 - 369 WP_020316649 type IV conjugative transfer system pilin TraA -
FOB35_RS29770 90052..90753 - 702 WP_223861285 hypothetical protein -
FOB35_RS00500 (FOB35_00500) 90991..91383 - 393 WP_020805752 conjugal transfer relaxosome DNA-binding protein TraM -
FOB35_RS00505 (FOB35_00505) 91886..92293 + 408 WP_020805750 transglycosylase SLT domain-containing protein -
FOB35_RS00510 (FOB35_00510) 92331..92861 - 531 WP_015632491 antirestriction protein -

Host bacterium

ID   21128 GenBank   NZ_CP044049
Plasmid name   FDAARGOS_627|unnamed1 Incompatibility group   IncFII
Plasmid size   213613 bp Coordinate of oriT [Strand]   91693..91741 [+]
Host baterium   Klebsiella variicola strain FDAARGOS_627

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -