Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   120601
Name   oriT_pOXA-48_P7699 in_silico
Organism   Citrobacter freundii strain P7699
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP071908 (9002..9107 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      30..35, 41..46  (CCGCCG..CGGCGG)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 106 nt

>oriT_pOXA-48_P7699
AGTACGGGACAAGATGTGTTTTTGGAGTACCGCCGACACGCGGCGGCCGTCCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTATCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   12977 GenBank   WP_004187323
Name   traI_J3S88_RS24860_pOXA-48_P7699 insolico UniProt ID   A0A3U8KUL3
Length   659 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75179.89 Da        Isoelectric Point: 9.9948

>WP_004187323.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

(86-334)


  Protein structure


Source ID Structure
AlphaFold DB A0A3U8KUL3


T4CP


ID   15238 GenBank   WP_004206885
Name   t4cp2_J3S88_RS24975_pOXA-48_P7699 insolico UniProt ID   _
Length   695 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 695 a.a.        Molecular weight: 79538.91 Da        Isoelectric Point: 4.8317

>WP_004206885.1 MULTISPECIES: conjugal transfer protein TrbC [Enterobacterales]
MQQESVDSKKVLRPDGSFMEWFLTPNVQFGLLAILTVLGLFLPFTMLLSILILPPLMVAFTDRKFRPPLR
MPKDCEMFDDTLTTETQAEYRLGPIRIPHKVRERKKAKGILYVGYERGRLFGRELWLNMTDLLRHMVFFG
TTGSGKTETFYGFIVNFLLWCRGYCLSDGKADNKLAFATWSLARRFGREDDYYVLNLLTGSIDRFVNLVK
QESIPAQSNSVNLFSVAPPTFIIQLMESMLPQVGGDSAQWQDTAKAMMSALINALCYKRARGELLLSQRT
IQKNMSLPAMAALYVEAKKNGWHSEGYAALESYLENTPGFLLANAEYPETWEARAFEQHNYMSRQFLKTL
SLFNETYGHVFPEDSGDIRMDDIFHNDRILIVMIPSLELSRGEAATLGRLYVTLQRMTISKDLGYQLEGK
KEEVLLTHALNNQAPYGLIYDELGQYFTSGMDTLSAQMRSLEKMGVFSSQDHPSLARGANGEVDSLIANT
RVKYFESIEDRKTFEILRETVGQDYYSELSGQEAEHGTFSKTVREGDLYQIREKDRVNIRELRKQTEGQG
VISFQDALVRSAAFYIPDNEKFSSELPMRINRFIEVLPPSPATLYSIYPERKDDELAETNPDAMRFPPIK
LFGYDKAANSLLEKIEVFYELQCGAISPEEMSVCLFELFAEWLDGTETDDVLYHQEDDLFPMIEM

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 11903..39245

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
J3S88_RS24840 (J3S88_24700) 6987..7298 + 312 WP_004187333 hypothetical protein -
J3S88_RS24845 (J3S88_24705) 7431..7967 + 537 WP_004187332 hypothetical protein -
J3S88_RS24850 (J3S88_24710) 8469..8864 - 396 WP_019725163 hypothetical protein -
J3S88_RS24855 8899..9426 + 528 WP_172740549 plasmid mobilization protein MobA -
J3S88_RS24860 (J3S88_24720) 9413..11392 + 1980 WP_004187323 TraI/MobA(P) family conjugative relaxase -
J3S88_RS24865 (J3S88_24725) 11406..11906 + 501 WP_004187320 DotD/TraH family lipoprotein -
J3S88_RS24870 (J3S88_24730) 11903..12682 + 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
J3S88_RS24875 (J3S88_24735) 12693..13856 + 1164 WP_004187313 plasmid transfer ATPase TraJ virB11
J3S88_RS24880 (J3S88_24740) 13846..14106 + 261 WP_004187310 IcmT/TraK family protein traK
J3S88_RS24885 14131..17568 + 3438 WP_015586048 LPD7 domain-containing protein -
J3S88_RS24890 (J3S88_24750) 17534..18046 + 513 WP_011091071 hypothetical protein traL
J3S88_RS24895 (J3S88_24755) 18047..18259 - 213 WP_305953721 Hha/YmoA family nucleoid-associated regulatory protein -
J3S88_RS24900 (J3S88_24760) 18231..18641 - 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
J3S88_RS24905 (J3S88_24765) 18709..19422 + 714 WP_004187467 DotI/IcmL family type IV secretion protein traM
J3S88_RS24910 (J3S88_24770) 19431..20582 + 1152 WP_004187471 DotH/IcmK family type IV secretion protein traN
J3S88_RS24915 (J3S88_24775) 20594..21943 + 1350 WP_004187474 conjugal transfer protein TraO traO
J3S88_RS24920 (J3S88_24780) 21955..22659 + 705 WP_015060002 conjugal transfer protein TraP traP
J3S88_RS24925 (J3S88_24785) 22683..23213 + 531 WP_004187478 conjugal transfer protein TraQ traQ
J3S88_RS24930 (J3S88_24790) 23230..23619 + 390 WP_004187479 DUF6750 family protein traR
J3S88_RS24935 (J3S88_24795) 23665..24159 + 495 WP_004187480 hypothetical protein -
J3S88_RS24940 (J3S88_24800) 24633..27206 + 2574 WP_227640156 conjugal transfer protein traU
J3S88_RS24945 (J3S88_24805) 27203..28411 + 1209 WP_011091082 conjugal transfer protein TraW traW
J3S88_RS24950 (J3S88_24810) 28408..29004 + 597 WP_015060003 hypothetical protein -
J3S88_RS24955 (J3S88_24815) 28997..31192 + 2196 WP_015062834 DotA/TraY family protein traY
J3S88_RS24960 (J3S88_24820) 31194..31847 + 654 WP_015060005 hypothetical protein -
J3S88_RS24965 (J3S88_24825) 31928..32158 + 231 WP_011091085 IncL/M type plasmid replication protein RepC -
J3S88_RS24970 (J3S88_24830) 32454..33509 + 1056 WP_015060006 plasmid replication initiator RepA -
J3S88_RS29585 34731..34826 + 96 WP_004206884 DinQ-like type I toxin DqlB -
J3S88_RS24975 (J3S88_24835) 34877..36964 - 2088 WP_004206885 conjugal transfer protein TrbC -
J3S88_RS24980 (J3S88_24840) 36977..37927 - 951 WP_004206886 DsbC family protein trbB
J3S88_RS24985 (J3S88_24845) 37938..39245 - 1308 WP_015059988 hypothetical protein trbA
J3S88_RS24990 (J3S88_24850) 39245..39640 - 396 WP_004187436 lytic transglycosylase domain-containing protein -
J3S88_RS24995 (J3S88_24855) 39745..40095 - 351 WP_124065455 DUF1496 domain-containing protein -
J3S88_RS25000 (J3S88_24860) 40208..40642 + 435 Protein_45 CPBP family intramembrane glutamate endopeptidase -
J3S88_RS25005 (J3S88_24865) 40657..41862 - 1206 WP_025987686 IS4-like element IS10A family transposase -
J3S88_RS25015 (J3S88_24875) 42775..43572 + 798 WP_015059991 OXA-48 family carbapenem-hydrolyzing class D beta-lactamase OXA-48 -


Host bacterium


ID   21030 GenBank   NZ_CP071908
Plasmid name   pOXA-48_P7699 Incompatibility group   IncL/M
Plasmid size   63064 bp Coordinate of oriT [Strand]   9002..9107 [+]
Host baterium   Citrobacter freundii strain P7699

Cargo genes


Drug resistance gene   blaOXA-48
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -