Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   120588
Name   oriT_2022CK-00369|unnamed5 in_silico
Organism   Citrobacter freundii strain 2022CK-00369
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP115619 (44807..44905 [+], 99 nt)
oriT length   99 nt
IRs (inverted repeats)      77..82, 89..94  (AAAAAA..TTTTTT)
 77..82, 88..93  (AAAAAA..TTTTTT)
 31..38, 41..48  (AGCGTGAT..ATCACGCT)
 17..23, 35..41  (TAAATCA..TGATTTA)
Location of nic site      59..60
Conserved sequence flanking the
  nic site  
 
 GGTGTATAGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 99 nt

>oriT_2022CK-00369|unnamed5
TTTGTTTTTTTTCTTTTAAATCAGTGCGATAGCGTGATTTATCACGCTGCGTTAGGTGTATAGCAGGTTAAGGGATAAAAAATCATCTTTTTTTGGTAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   12967 GenBank   WP_000130000
Name   Replic_Relax_PF691_RS28800_2022CK-00369|unnamed5 insolico UniProt ID   R4WML4
Length   101 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 101 a.a.        Molecular weight: 11477.11 Da        Isoelectric Point: 7.5204

>WP_000130000.1 MULTISPECIES: PadR family transcriptional regulator [Pseudomonadota]
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG

  Protein domains


Predicted by InterproScan.

(15-84)


  Protein structure


Source ID Structure
AlphaFold DB R4WML4


Host bacterium


ID   21017 GenBank   NZ_CP115619
Plasmid name   2022CK-00369|unnamed5 Incompatibility group   IncR
Plasmid size   48003 bp Coordinate of oriT [Strand]   44807..44905 [+]
Host baterium   Citrobacter freundii strain 2022CK-00369

Cargo genes


Drug resistance gene   aph(3')-Ia, mph(A), sul1, qacE, ARR-3, catB3, blaOXA-1, aac(6')-Ib-cr, tet(A)
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -