Detailed information of oriT
oriT
The information of the oriT region
oriTDB ID | 120588 |
Name | oriT_2022CK-00369|unnamed5 |
Organism | Citrobacter freundii strain 2022CK-00369 |
Sequence Completeness | - |
NCBI accession of oriT (coordinates [strand]) | NZ_CP115619 (44807..44905 [+], 99 nt) |
oriT length | 99 nt |
IRs (inverted repeats) | 77..82, 89..94 (AAAAAA..TTTTTT) 77..82, 88..93 (AAAAAA..TTTTTT) 31..38, 41..48 (AGCGTGAT..ATCACGCT) 17..23, 35..41 (TAAATCA..TGATTTA) |
Location of nic site | 59..60 |
Conserved sequence flanking the nic site |
GGTGTATAGC |
Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 99 nt
>oriT_2022CK-00369|unnamed5
TTTGTTTTTTTTCTTTTAAATCAGTGCGATAGCGTGATTTATCACGCTGCGTTAGGTGTATAGCAGGTTAAGGGATAAAAAATCATCTTTTTTTGGTAG
TTTGTTTTTTTTCTTTTAAATCAGTGCGATAGCGTGATTTATCACGCTGCGTTAGGTGTATAGCAGGTTAAGGGATAAAAAATCATCTTTTTTTGGTAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure fileRelaxase
ID | 12967 | GenBank | WP_000130000 |
Name | Replic_Relax_PF691_RS28800_2022CK-00369|unnamed5 | UniProt ID | R4WML4 |
Length | 101 a.a. | PDB ID | |
Note | Predicted by oriTfinder 2.0 |
Relaxase protein sequence
Download Length: 101 a.a. Molecular weight: 11477.11 Da Isoelectric Point: 7.5204
>WP_000130000.1 MULTISPECIES: PadR family transcriptional regulator [Pseudomonadota]
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG
Protein domains
Predicted by InterproScan.
Protein structure
Source | ID | Structure |
---|---|---|
AlphaFold DB | R4WML4 |
Host bacterium
ID | 21017 | GenBank | NZ_CP115619 |
Plasmid name | 2022CK-00369|unnamed5 | Incompatibility group | IncR |
Plasmid size | 48003 bp | Coordinate of oriT [Strand] | 44807..44905 [+] |
Host baterium | Citrobacter freundii strain 2022CK-00369 |
Cargo genes
Drug resistance gene | aph(3')-Ia, mph(A), sul1, qacE, ARR-3, catB3, blaOXA-1, aac(6')-Ib-cr, tet(A) |
Virulence gene | - |
Metal resistance gene | - |
Degradation gene | - |
Symbiosis gene | - |
Anti-CRISPR | - |