Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   120438
Name   oriT_p4-L2724hy in_silico
Organism   Citrobacter portucalensis strain L2724hy
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP136605 (20397..20495 [+], 99 nt)
oriT length   99 nt
IRs (inverted repeats)      77..82, 89..94  (AAAAAA..TTTTTT)
 77..82, 88..93  (AAAAAA..TTTTTT)
 31..38, 41..48  (AGCGTGAT..ATCACGCT)
 17..23, 35..41  (TAAATCA..TGATTTA)
Location of nic site      59..60
Conserved sequence flanking the
  nic site  
 
 GGTGTATAGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 99 nt

>oriT_p4-L2724hy
TTTGTTTTTTTTCTTTTAAATCAGTGCGATAGCGTGATTTATCACGCTGCGTTAGGTGTATAGCAGGTTAAGGGATAAAAAATCATCTTTTTTTGGTAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   12873 GenBank   WP_000130000
Name   Replic_Relax_RY846_RS27215_p4-L2724hy insolico UniProt ID   R4WML4
Length   101 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 101 a.a.        Molecular weight: 11477.11 Da        Isoelectric Point: 7.5204

>WP_000130000.1 MULTISPECIES: PadR family transcriptional regulator [Pseudomonadota]
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG

  Protein domains


Predicted by InterproScan.

(15-84)


  Protein structure


Source ID Structure
AlphaFold DB R4WML4


Host bacterium


ID   20867 GenBank   NZ_CP136605
Plasmid name   p4-L2724hy Incompatibility group   IncR
Plasmid size   45944 bp Coordinate of oriT [Strand]   20397..20495 [+]
Host baterium   Citrobacter portucalensis strain L2724hy

Cargo genes


Drug resistance gene   mph(A)
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -