Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   120401
Name   oriT_p24A19019_A_KPC in_silico
Organism   Enterobacter hormaechei subsp. steigerwaltii strain 24A19CPO019
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_OQ821163 (44304..44409 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      30..35, 41..46  (CCGCCG..CGGCGG)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 106 nt

>oriT_p24A19019_A_KPC
AGTACGGGACAAGATGTGTTTTTGGAGTACCGCCGACACGCGGCGGCCGTCCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTATCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   12841 GenBank   WP_004187323
Name   traI_SLH58_RS00320_p24A19019_A_KPC insolico UniProt ID   A0A3U8KUL3
Length   659 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75179.89 Da        Isoelectric Point: 9.9948

>WP_004187323.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(86-334)


  Protein structure


Source ID Structure
AlphaFold DB A0A3U8KUL3


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 47205..66533

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SLH58_RS00300 (MOCKNAFM_00058) 42291..42602 + 312 WP_004187333 hypothetical protein -
SLH58_RS00305 (MOCKNAFM_00059) 42734..43270 + 537 WP_011091066 hypothetical protein -
SLH58_RS00310 (MOCKNAFM_00061) 43771..44166 - 396 WP_020805633 hypothetical protein -
SLH58_RS00315 44165..44728 + 564 WP_319382137 plasmid mobilization protein MobA -
SLH58_RS00320 (MOCKNAFM_00063) 44715..46694 + 1980 WP_004187323 TraI/MobA(P) family conjugative relaxase -
SLH58_RS00325 (MOCKNAFM_00064) 46708..47208 + 501 WP_004187320 DotD/TraH family lipoprotein -
SLH58_RS00330 (MOCKNAFM_00065) 47205..47984 + 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
SLH58_RS00335 (MOCKNAFM_00066) 47995..49158 + 1164 WP_020805653 plasmid transfer ATPase TraJ virB11
SLH58_RS00340 (MOCKNAFM_00067) 49148..49408 + 261 WP_004187310 IcmT/TraK family protein traK
SLH58_RS00345 (MOCKNAFM_00068) 49433..52870 + 3438 WP_319382138 LPD7 domain-containing protein -
SLH58_RS00350 (MOCKNAFM_00069) 52794..53348 + 555 WP_011154467 hypothetical protein traL
SLH58_RS00355 (MOCKNAFM_00070) 53349..53546 - 198 WP_004187464 Hha/YmoA family nucleoid-associated regulatory protein -
SLH58_RS00360 (MOCKNAFM_00071) 53533..53943 - 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
SLH58_RS00365 (MOCKNAFM_00072) 53942..54724 + 783 WP_004206929 DotI/IcmL family type IV secretion protein traM
SLH58_RS00370 (MOCKNAFM_00073) 54760..55884 + 1125 WP_319382139 DotH/IcmK family type IV secretion protein traN
SLH58_RS00375 (MOCKNAFM_00074) 55896..57245 + 1350 WP_020805691 conjugal transfer protein TraO traO
SLH58_RS00380 (MOCKNAFM_00075) 57257..57961 + 705 WP_020805696 conjugal transfer protein TraP traP
SLH58_RS00385 (MOCKNAFM_00076) 57985..58515 + 531 WP_011091077 conjugal transfer protein TraQ traQ
SLH58_RS00390 (MOCKNAFM_00077) 58532..58921 + 390 WP_020805690 DUF6750 family protein traR
SLH58_RS00395 (MOCKNAFM_00078) 58967..59461 + 495 WP_223294957 hypothetical protein -
SLH58_RS00400 (MOCKNAFM_00079) 59458..62508 + 3051 WP_020805687 ATPase AAA traU
SLH58_RS00405 (MOCKNAFM_00080) 62538..63713 + 1176 WP_167577398 conjugal transfer protein TraW traW
SLH58_RS00410 (MOCKNAFM_00081) 63710..64360 + 651 WP_032426814 hypothetical protein -
SLH58_RS00415 (MOCKNAFM_00082) 64353..66533 + 2181 WP_032426815 DotA/TraY family protein traY
SLH58_RS00420 (MOCKNAFM_00083) 66536..67189 + 654 WP_020805693 hypothetical protein -
SLH58_RS00425 (MOCKNAFM_00084) 67251..67493 + 243 WP_023893611 IncL/M type plasmid replication protein RepC -

Host bacterium

ID   20830 GenBank   NZ_OQ821163
Plasmid name   p24A19019_A_KPC Incompatibility group   IncL/M
Plasmid size   67789 bp Coordinate of oriT [Strand]   44304..44409 [+]
Host baterium   Enterobacter hormaechei subsp. steigerwaltii strain 24A19CPO019

Cargo genes

Drug resistance gene   blaKPC-3
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -