Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 120362 |
| Name | oriT_pCMP234-1  |
| Organism | Klebsiella quasipneumoniae strain OSUCMP263AKPC |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP087581 (166763..166812 [+], 50 nt) |
| oriT length | 50 nt |
| IRs (inverted repeats) | 7..14, 17..24 (GCAAAATT..AATTTTGC) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 50 nt
>oriT_pCMP234-1
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTCATTTTGTGGTGAG
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTCATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 15053 | GenBank | WP_023313941 |
| Name | traD_LO541_RS25550_pCMP234-1 |
UniProt ID | _ |
| Length | 769 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 769 a.a. Molecular weight: 85666.78 Da Isoelectric Point: 5.2499
>WP_023313941.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacterales]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGTADTNSHAGEQPEPVSQPA
PAEVTVSPAPVKAPATTKMPAAEPSARTAEPPVLRVTTVPLIKPKAAAAAAAAATASSAGTPAAAAGGTE
QELAQQSAEQGQDMLPAGMNKDGVIEDMQAYDAWADEQTLRDMQRREEVNINHSHRHDEQDDVEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGTADTNSHAGEQPEPVSQPA
PAEVTVSPAPVKAPATTKMPAAEPSARTAEPPVLRVTTVPLIKPKAAAAAAAAATASSAGTPAAAAGGTE
QELAQQSAEQGQDMLPAGMNKDGVIEDMQAYDAWADEQTLRDMQRREEVNINHSHRHDEQDDVEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 136419..167370
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LO541_RS25550 (LO541_25550) | 136419..138728 | - | 2310 | WP_023313941 | type IV conjugative transfer system coupling protein TraD | virb4 |
| LO541_RS25555 (LO541_25555) | 138855..139544 | - | 690 | WP_013023831 | hypothetical protein | - |
| LO541_RS25560 (LO541_25560) | 139737..140153 | - | 417 | Protein_150 | complement resistance protein TraT | - |
| LO541_RS25565 (LO541_25565) | 140186..141154 | + | 969 | WP_015958259 | IS5 family transposase | - |
| LO541_RS25570 (LO541_25570) | 141211..141532 | - | 322 | Protein_152 | complement resistance protein TraT | - |
| LO541_RS25575 (LO541_25575) | 141721..142248 | - | 528 | WP_032409657 | conjugal transfer protein TraS | - |
| LO541_RS25580 (LO541_25580) | 142254..145103 | - | 2850 | WP_023287129 | conjugal transfer mating-pair stabilization protein TraG | traG |
| LO541_RS25585 (LO541_25585) | 145103..146482 | - | 1380 | WP_072159474 | conjugal transfer pilus assembly protein TraH | traH |
| LO541_RS25590 (LO541_25590) | 146460..146903 | - | 444 | WP_023287131 | F-type conjugal transfer protein TrbF | - |
| LO541_RS25595 (LO541_25595) | 146949..147506 | - | 558 | WP_013214031 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| LO541_RS25600 (LO541_25600) | 147478..147717 | - | 240 | WP_004144400 | type-F conjugative transfer system pilin chaperone TraQ | - |
| LO541_RS25605 (LO541_25605) | 147728..148480 | - | 753 | WP_004152677 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| LO541_RS25610 (LO541_25610) | 148501..148827 | - | 327 | WP_004152676 | hypothetical protein | - |
| LO541_RS25615 (LO541_25615) | 148840..149088 | - | 249 | WP_013214029 | hypothetical protein | - |
| LO541_RS25620 (LO541_25620) | 149066..149320 | - | 255 | WP_023287133 | conjugal transfer protein TrbE | - |
| LO541_RS25625 (LO541_25625) | 149352..151307 | - | 1956 | WP_023287134 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| LO541_RS25630 (LO541_25630) | 151366..152013 | - | 648 | WP_064757794 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| LO541_RS25635 (LO541_25635) | 152289..153278 | - | 990 | WP_032439620 | conjugal transfer pilus assembly protein TraU | traU |
| LO541_RS25640 (LO541_25640) | 153275..153676 | - | 402 | WP_016831047 | hypothetical protein | - |
| LO541_RS25645 (LO541_25645) | 153711..154346 | - | 636 | WP_020325113 | type-F conjugative transfer system protein TraW | traW |
| LO541_RS25650 (LO541_25650) | 154346..154735 | - | 390 | WP_004167468 | type-F conjugative transfer system protein TrbI | - |
| LO541_RS25655 (LO541_25655) | 154735..157374 | - | 2640 | WP_032448278 | type IV secretion system protein TraC | virb4 |
| LO541_RS25660 (LO541_25660) | 157446..157844 | - | 399 | WP_072159473 | hypothetical protein | - |
| LO541_RS25665 (LO541_25665) | 157852..158241 | - | 390 | WP_065799586 | hypothetical protein | - |
| LO541_RS25670 (LO541_25670) | 158284..158688 | - | 405 | WP_016831042 | hypothetical protein | - |
| LO541_RS25675 (LO541_25675) | 158755..159066 | - | 312 | WP_014386200 | hypothetical protein | - |
| LO541_RS25680 (LO541_25680) | 159067..159285 | - | 219 | WP_014386199 | hypothetical protein | - |
| LO541_RS25685 (LO541_25685) | 159309..159599 | - | 291 | WP_014386198 | hypothetical protein | - |
| LO541_RS25690 (LO541_25690) | 159604..160014 | - | 411 | WP_014386197 | hypothetical protein | - |
| LO541_RS25695 (LO541_25695) | 160145..160729 | - | 585 | WP_014386196 | type IV conjugative transfer system lipoprotein TraV | traV |
| LO541_RS25700 (LO541_25700) | 160776..161348 | - | 573 | WP_014386195 | conjugal transfer pilus-stabilizing protein TraP | - |
| LO541_RS25705 (LO541_25705) | 161341..162765 | - | 1425 | WP_014386194 | F-type conjugal transfer pilus assembly protein TraB | traB |
| LO541_RS25710 (LO541_25710) | 162765..163505 | - | 741 | WP_014386193 | type-F conjugative transfer system secretin TraK | traK |
| LO541_RS25715 (LO541_25715) | 163492..164058 | - | 567 | WP_004152602 | type IV conjugative transfer system protein TraE | traE |
| LO541_RS25720 (LO541_25720) | 164078..164383 | - | 306 | WP_049110928 | type IV conjugative transfer system protein TraL | traL |
| LO541_RS25725 (LO541_25725) | 164397..164765 | - | 369 | WP_004194426 | type IV conjugative transfer system pilin TraA | - |
| LO541_RS25730 (LO541_25730) | 164827..165033 | - | 207 | WP_171773970 | TraY domain-containing protein | - |
| LO541_RS25735 (LO541_25735) | 165166..165885 | - | 720 | WP_014386192 | conjugal transfer protein | - |
| LO541_RS25740 (LO541_25740) | 166078..166494 | - | 417 | WP_072145360 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| LO541_RS25745 (LO541_25745) | 166885..167370 | + | 486 | WP_004178063 | transglycosylase SLT domain-containing protein | virB1 |
| LO541_RS25750 (LO541_25750) | 167403..167732 | - | 330 | WP_014386191 | DUF5983 family protein | - |
| LO541_RS25755 (LO541_25755) | 167765..168586 | - | 822 | WP_004182076 | DUF932 domain-containing protein | - |
| LO541_RS25760 (LO541_25760) | 169419..169832 | - | 414 | WP_013023817 | type II toxin-antitoxin system HigA family antitoxin | - |
| LO541_RS25765 (LO541_25765) | 169833..170111 | - | 279 | WP_004152721 | helix-turn-helix transcriptional regulator | - |
| LO541_RS25770 (LO541_25770) | 170101..170421 | - | 321 | WP_004152720 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| LO541_RS25775 (LO541_25775) | 170502..170726 | - | 225 | WP_014386189 | hypothetical protein | - |
Host bacterium
| ID | 20791 | GenBank | NZ_CP087581 |
| Plasmid name | pCMP234-1 | Incompatibility group | IncFIB |
| Plasmid size | 170849 bp | Coordinate of oriT [Strand] | 166763..166812 [+] |
| Host baterium | Klebsiella quasipneumoniae strain OSUCMP263AKPC |
Cargo genes
| Drug resistance gene | sul2, aph(3'')-Ib, aph(6)-Id, blaTEM-1B, blaCTX-M-15, aac(3)-IIa, qnrB1, tet(A), aac(6')-Ib-cr, blaOXA-1, dfrA14 |
| Virulence gene | - |
| Metal resistance gene | silE, silS, silR, silC, silF, silB, silA, silP, pcoA, pcoB, pcoC, pcoD, pcoR, pcoS, pcoE, arsB, arsC, arsH |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |