Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   120312
Name   oriT_pCY-OXA-1_ in_silico
Organism   Citrobacter youngae isolate BB1468
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_LR822053 (28202..28300 [-], 99 nt)
oriT length   99 nt
IRs (inverted repeats)      77..82, 89..94  (AAAAAA..TTTTTT)
 77..82, 88..93  (AAAAAA..TTTTTT)
 31..38, 41..48  (AGCGTGAT..ATCACGCT)
 17..23, 35..41  (TAAATCA..TGATTTA)
Location of nic site      59..60
Conserved sequence flanking the
  nic site    		  GGTGTATAGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 99 nt

>oriT_pCY-OXA-1_
TTTGTTTTTTTTCTTTTAAATCAGTGCGATAGCGTGATTTATCACGCTGCGTTAGGTGTATAGCAGGTTAAGGGATAAAAAATCATCTTTTTTTGGTAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   12777 GenBank   WP_000130000
Name   Replic_Relax_L1W23_RS00025_pCY-OXA-1_ insolico UniProt ID   R4WML4
Length   101 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 101 a.a.        Molecular weight: 11477.11 Da        Isoelectric Point: 7.5204

>WP_000130000.1 MULTISPECIES: PadR family transcriptional regulator [Pseudomonadota]
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG

  Protein domains


Predicted by InterproScan.

Transcriptional regulator PadR-like family (PadR)

(15-84)


  Protein structure


Source ID Structure
AlphaFold DB R4WML4


Host bacterium

ID   20741 GenBank   NZ_LR822053
Plasmid name   pCY-OXA-1_ Incompatibility group   IncR
Plasmid size   54473 bp Coordinate of oriT [Strand]   28202..28300 [-]
Host baterium   Citrobacter youngae isolate BB1468

Cargo genes

Drug resistance gene   sul1, mph(A), aac(6')-Ib-cr, blaOXA-1, catB3, ARR-3, qacE, qnrB4, blaDHA-1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -