Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   120295
Name   oriT_pKM0252a in_silico
Organism   Serratia sarumanii strain K-M0252
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP142098 (43679..43762 [+], 84 nt)
oriT length   84 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 84 nt

>oriT_pKM0252a
ACGGGACAGGATATGTTTTGTAGCACCGCCTGCACGCAGTCGGCTCTACAAAACGTCCTGGTCAGGGCAGAGCCCCGACACCCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   12766 GenBank   WP_128884968
Name   traI_VOT21_RS24405_pKM0252a insolico UniProt ID   _
Length   642 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 642 a.a.        Molecular weight: 73003.42 Da        Isoelectric Point: 7.5269

>WP_128884968.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Serratia]
MIPIVPEKRRDGRSSFIQLVSYLTLRDEDKPDLPISPENPYVRPSRSKAAIFDRLVGYLDRNAGGGQQTL
LAMFADGTQQVKSGEVVCETNCFSLETASAEMNAVAMQNTRCVDPVYHCILSWREEDTPTDQQIFESARY
CINQLGMADHQYVFAVHRDTDNVHCHIAVNRIHPESYRAANMYKDVDTLHKACRHLELKHGFTPDNGAWK
VNEHQQVVRSQNEFKCIPRKARQLEYYADSESLFSYAVGECRQAIGDIMADPERLSWQNLHNELNRAGLV
LKQKGEGLAIYSIQDSSLPPIKASGLHPDLTRSCMEPYLGEFTSALDVDAVASPKHPEYVYDPRFHARDL
MARVERRQARAEARADLKARYQAYKSAWVRPKLDADEIKARYKNMSKRFAWRKAKARVELRDPLLRKLTY
HIIEVERMKAMAALRLAIKEERQAFKAAPENRRLSYRGWVEQQALMHDQAAIAQLRGWSYRLKRSSLTPS
VSLNGIRFAVSDDSKPLAIDGYQTRIMRDGVVQYVQNGVVQLQDRGERIEVADSQVMDGQHIITGLVIAQ
SKSGEEMVLEGDRQYVQQSCELVSWFNEESGTSLPLTETSQRTLAGYGSLPTENSHGATDSSVNEQRELD
GYIQRPNGPRPH

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(87-313)


  Protein structure



No available structure.




T4CP

ID   14984 GenBank   WP_238476109
Name   trbC_VOT21_RS24420_pKM0252a insolico UniProt ID   _
Length   726 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 726 a.a.        Molecular weight: 81578.18 Da        Isoelectric Point: 7.9811

>WP_238476109.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Serratia]
MSQPVEVDVRRVRRPLGQTIIQDALLSPIGVQLSLAGAIGLAIHSPASLLLTTPAALLQLMLFGDQPFRM
PLRLPTDIGGMDLTTEREMPKYRNGIGGFFRYVVRTRKYQRAAGVMCLGFARGKALARELWLTLDDALRH
MLLLATTGSGKTEALLSVFLNAICWGRGICYSDGKGQNTLAFAMWSLARRFGREDDFYVLNFMTGGSDKL
LQLLLNDKKRQPSNTINLFGTANTTFIIQLMESMLPPAGSGDQGWQDKAKSMLAALVYAVYYKCKREKRR
ISQRVIQEYLPLRKLAELYLEAKRDGWHQEAYNPLENYFNTLAGFRIELISRPSEWEQGVYDQHGYLIQQ
FNRMLTMFNDLYGHIFSTDAGDVDIEDVLHNDRILCTTIPALELSKGEAANIGKLYISAIRMTMARDLGF
ELEGMMNDVLIVKKYKGNFPFPIAMDELGAYFGPGMDNLASQMRSLGYMLIVSAQDIQRFIAEHKGEYMT
VNANLLTKWFMTLQDEKDTFELARITGGKGYYSELGAVEQQGGLITPHFEDAGSNVIREKDRLDLGDLKD
MNPGEGMISFKSALIPSNAIYIQDDDKMTSALPMRINRFVNLDMPTEAELLDANPTLKKKLPPSAQEVET
ILTRLESPPSQTTCNGLMDPVLQSVVALSLDLNHRADVSYTPAQRGILLFEAARVALKLHKRRWKQQPTA
PKPIRVSKDIAKALATSEHHREERYG

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 49037..76897

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
VOT21_RS24405 (VOT21_24405) 44143..46071 + 1929 WP_128884968 TraI/MobA(P) family conjugative relaxase -
VOT21_RS24410 (VOT21_24410) 46124..46441 - 318 WP_128884969 hypothetical protein -
VOT21_RS24415 (VOT21_24415) 46438..46731 - 294 WP_161568992 hypothetical protein -
VOT21_RS24420 (VOT21_24420) 46800..48980 - 2181 WP_238476109 F-type conjugative transfer protein TrbC -
VOT21_RS24425 (VOT21_24425) 49037..49975 - 939 WP_128884971 hypothetical protein trbB
VOT21_RS24430 (VOT21_24430) 50000..51325 - 1326 WP_147823515 conjugal transfer protein TrbA trbA
VOT21_RS24435 (VOT21_24435) 51472..52050 - 579 WP_128884972 hypothetical protein -
VOT21_RS24440 (VOT21_24440) 52047..54191 - 2145 WP_128884973 DotA/TraY family protein traY
VOT21_RS24445 (VOT21_24445) 54238..54807 - 570 WP_128884974 conjugal transfer protein TraX -
VOT21_RS24450 (VOT21_24450) 54800..56020 - 1221 WP_147823517 conjugal transfer protein TraW traW
VOT21_RS24455 (VOT21_24455) 56151..59225 - 3075 WP_128884975 ATP-binding protein traU
VOT21_RS24460 (VOT21_24460) 59228..59833 - 606 WP_128884976 hypothetical protein traT
VOT21_RS24465 (VOT21_24465) 59894..60298 - 405 WP_128884977 DUF6750 family protein traR
VOT21_RS24470 (VOT21_24470) 60314..60844 - 531 WP_128884978 conjugal transfer protein TraQ traQ
VOT21_RS24475 (VOT21_24475) 60853..61623 - 771 WP_128884979 hypothetical protein traP
VOT21_RS24480 (VOT21_24480) 61623..62837 - 1215 WP_128884980 conjugal transfer protein TraO traO
VOT21_RS24485 (VOT21_24485) 62842..63831 - 990 WP_128884981 DotH/IcmK family type IV secretion protein traN
VOT21_RS24490 (VOT21_24490) 63833..64504 - 672 WP_128884982 DotI/IcmL/TraM family protein traM
VOT21_RS24495 (VOT21_24495) 64592..65071 - 480 WP_238476110 hypothetical protein traL
VOT21_RS24500 (VOT21_24500) 65080..68310 - 3231 WP_128884983 LPD7 domain-containing protein -
VOT21_RS24505 (VOT21_24505) 68324..68623 - 300 WP_128884984 IcmT/TraK family protein traK
VOT21_RS24510 (VOT21_24510) 68620..69780 - 1161 WP_128884985 plasmid transfer ATPase TraJ virB11
VOT21_RS24515 (VOT21_24515) 69794..70582 - 789 WP_128884986 type IV secretory system conjugative DNA transfer family protein traI
VOT21_RS24520 (VOT21_24520) 70579..71037 - 459 WP_240039789 DotD/TraH family lipoprotein -
VOT21_RS24525 (VOT21_24525) 71063..72463 - 1401 WP_128884987 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
VOT21_RS24530 (VOT21_24530) 72460..73128 - 669 WP_128884988 A24 family peptidase -
VOT21_RS24535 (VOT21_24535) 73128..73613 - 486 WP_128884989 lytic transglycosylase domain-containing protein virB1
VOT21_RS24540 (VOT21_24540) 73668..74258 - 591 WP_128884990 type 4 pilus major pilin -
VOT21_RS24545 (VOT21_24545) 74295..75410 - 1116 WP_128884991 type II secretion system F family protein -
VOT21_RS24550 (VOT21_24550) 75407..76897 - 1491 WP_128884992 GspE/PulE family protein virB11
VOT21_RS24555 (VOT21_24555) 76903..77475 - 573 WP_128884993 type IV pilus biogenesis protein PilP -
VOT21_RS24560 (VOT21_24560) 77462..78760 - 1299 WP_128884994 type 4b pilus protein PilO2 -
VOT21_RS24565 (VOT21_24565) 78764..80395 - 1632 WP_128884995 PilN family type IVB pilus formation outer membrane protein -
VOT21_RS24570 (VOT21_24570) 80417..80839 - 423 WP_128884996 type IV pilus biogenesis protein PilM -
VOT21_RS24575 (VOT21_24575) 80839..81819 - 981 WP_128884997 toxin co-regulated pilus biosynthesis Q family protein -

Host bacterium

ID   20724 GenBank   NZ_CP142098
Plasmid name   pKM0252a Incompatibility group   -
Plasmid size   83783 bp Coordinate of oriT [Strand]   43679..43762 [+]
Host baterium   Serratia sarumanii strain K-M0252

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -