Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   120294
Name   oriT_pKM0228a in_silico
Organism   Serratia sarumanii strain K-M0228
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP142090 (43682..43765 [+], 84 nt)
oriT length   84 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 84 nt

>oriT_pKM0228a
ACGGGACAGGATATGTTTTGTAGCACCGCCTGCACGCAGTCGGCTCTACAAAACGTCCTGGTCAGGGCAGAGCCCCGACACCCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   12765 GenBank   WP_128884968
Name   traI_VOT19_RS24315_pKM0228a insolico UniProt ID   _
Length   642 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 642 a.a.        Molecular weight: 73003.42 Da        Isoelectric Point: 7.5269

>WP_128884968.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Serratia]
MIPIVPEKRRDGRSSFIQLVSYLTLRDEDKPDLPISPENPYVRPSRSKAAIFDRLVGYLDRNAGGGQQTL
LAMFADGTQQVKSGEVVCETNCFSLETASAEMNAVAMQNTRCVDPVYHCILSWREEDTPTDQQIFESARY
CINQLGMADHQYVFAVHRDTDNVHCHIAVNRIHPESYRAANMYKDVDTLHKACRHLELKHGFTPDNGAWK
VNEHQQVVRSQNEFKCIPRKARQLEYYADSESLFSYAVGECRQAIGDIMADPERLSWQNLHNELNRAGLV
LKQKGEGLAIYSIQDSSLPPIKASGLHPDLTRSCMEPYLGEFTSALDVDAVASPKHPEYVYDPRFHARDL
MARVERRQARAEARADLKARYQAYKSAWVRPKLDADEIKARYKNMSKRFAWRKAKARVELRDPLLRKLTY
HIIEVERMKAMAALRLAIKEERQAFKAAPENRRLSYRGWVEQQALMHDQAAIAQLRGWSYRLKRSSLTPS
VSLNGIRFAVSDDSKPLAIDGYQTRIMRDGVVQYVQNGVVQLQDRGERIEVADSQVMDGQHIITGLVIAQ
SKSGEEMVLEGDRQYVQQSCELVSWFNEESGTSLPLTETSQRTLAGYGSLPTENSHGATDSSVNEQRELD
GYIQRPNGPRPH

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(87-313)


  Protein structure



No available structure.




T4CP

ID   14983 GenBank   WP_282495020
Name   trbC_VOT19_RS24330_pKM0228a insolico UniProt ID   _
Length   726 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 726 a.a.        Molecular weight: 81568.14 Da        Isoelectric Point: 7.9811

>WP_282495020.1 MULTISPECIES: F-type conjugative transfer protein TrbC [unclassified Serratia (in: enterobacteria)]
MSQPVEVDVRRVRRPLGQTIIQDALLSPIGVQLSLAGAIGLAIHSPASLLLTTPAALLQLMLFGDQPFRM
PLRLPTDIGGMDLTTEREMPKYRNGIGGFFRYVVRTRKYQRAAGVMCLGFARGKALARELWLTLDDALRH
MLLLATTGSGKTEALLSVFLNAICWGRGICYSDGKGQNTLAFAMWSLARRFGREDDFYVLNFMTGGSDKL
LQLLLNDKKRQPSNTINLFGTANTTFIIQLMESMLPPAGSGDQGWQDKAKSMLAALVYAVYYKCKREKRR
ISQRVIQEYLPLRKLAELYLEAKRDGWHQEAYNPLENYFNTLAGFRIELISRPSEWEQGVYDQHGYLIQQ
FNRMLTMFNDLYGHIFSTDAGDVDIEDVLHNDRILCTTIPALELSKGEAANIGKLYISAIRMTMARDLGF
ELEGMMNDVLIVKKYKGNFPFPIAMDELGAYFGPGMDNLASQMRSLGYMLIVSAQDIQRFIAEHKGEYMT
VNANLLTKWFMTLQDEKDTFELARITGGKGYYSELGAVEQQGGLITPHFEDAGSNVIREKDRLDLGDLKD
MNPGEGMISFKSALIPSNAIYIQDDDKMTSALPMRINRFVNLDMPTEAELLDANPTLKKKLPPSAQEVET
ILTRLESPPSQTTCNGLMDPVLQSVVALSLDLNHRADVSYTSAQRGILLFEAARVALKLHKRRWKQQPTA
PKPIRVSKDIAKALATSEHHREERYG

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 49040..76892

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
VOT19_RS24315 (VOT19_24315) 44146..46074 + 1929 WP_128884968 TraI/MobA(P) family conjugative relaxase -
VOT19_RS24320 (VOT19_24320) 46127..46444 - 318 WP_128884969 hypothetical protein -
VOT19_RS24325 (VOT19_24325) 46441..46734 - 294 WP_161568992 hypothetical protein -
VOT19_RS24330 (VOT19_24330) 46803..48983 - 2181 WP_282495020 F-type conjugative transfer protein TrbC -
VOT19_RS24335 (VOT19_24335) 49040..49978 - 939 WP_128884971 hypothetical protein trbB
VOT19_RS24340 (VOT19_24340) 50003..51328 - 1326 WP_147823515 conjugal transfer protein TrbA trbA
VOT19_RS24345 (VOT19_24345) 51475..52053 - 579 WP_128884972 hypothetical protein -
VOT19_RS24350 (VOT19_24350) 52050..54194 - 2145 WP_128884973 DotA/TraY family protein traY
VOT19_RS24355 (VOT19_24355) 54241..54810 - 570 WP_128884974 conjugal transfer protein TraX -
VOT19_RS24360 (VOT19_24360) 54803..56023 - 1221 WP_147823517 conjugal transfer protein TraW traW
VOT19_RS24365 (VOT19_24365) 56154..59228 - 3075 WP_128884975 ATP-binding protein traU
VOT19_RS24370 (VOT19_24370) 59231..59836 - 606 WP_128884976 hypothetical protein traT
VOT19_RS24375 (VOT19_24375) 59897..60043 - 147 WP_325985543 DUF6750 family protein traR
VOT19_RS24380 (VOT19_24380) 60090..60293 - 204 WP_325985544 DUF6750 family protein traR
VOT19_RS24385 (VOT19_24385) 60309..60839 - 531 WP_128884978 conjugal transfer protein TraQ traQ
VOT19_RS24390 (VOT19_24390) 60848..61618 - 771 WP_128884979 hypothetical protein traP
VOT19_RS24395 (VOT19_24395) 61618..62832 - 1215 WP_128884980 conjugal transfer protein TraO traO
VOT19_RS24400 (VOT19_24400) 62837..63826 - 990 WP_128884981 DotH/IcmK family type IV secretion protein traN
VOT19_RS24405 (VOT19_24405) 63828..64499 - 672 WP_128884982 DotI/IcmL/TraM family protein traM
VOT19_RS24410 (VOT19_24410) 64587..65066 - 480 WP_238476110 hypothetical protein traL
VOT19_RS24415 (VOT19_24415) 65075..68305 - 3231 WP_128884983 LPD7 domain-containing protein -
VOT19_RS24420 (VOT19_24420) 68319..68618 - 300 WP_128884984 IcmT/TraK family protein traK
VOT19_RS24425 (VOT19_24425) 68615..69775 - 1161 WP_128884985 plasmid transfer ATPase TraJ virB11
VOT19_RS24430 (VOT19_24430) 69789..70577 - 789 WP_128884986 type IV secretory system conjugative DNA transfer family protein traI
VOT19_RS24435 (VOT19_24435) 70574..71032 - 459 WP_240039789 DotD/TraH family lipoprotein -
VOT19_RS24440 (VOT19_24440) 71058..72458 - 1401 WP_128884987 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
VOT19_RS24445 (VOT19_24445) 72455..73123 - 669 WP_128884988 A24 family peptidase -
VOT19_RS24450 (VOT19_24450) 73123..73608 - 486 WP_128884989 lytic transglycosylase domain-containing protein virB1
VOT19_RS24455 (VOT19_24455) 73663..74253 - 591 WP_128884990 type 4 pilus major pilin -
VOT19_RS24460 (VOT19_24460) 74290..75405 - 1116 WP_128884991 type II secretion system F family protein -
VOT19_RS24465 (VOT19_24465) 75402..76892 - 1491 WP_128884992 GspE/PulE family protein virB11
VOT19_RS24470 (VOT19_24470) 76898..77470 - 573 WP_128884993 type IV pilus biogenesis protein PilP -
VOT19_RS24475 (VOT19_24475) 77457..78755 - 1299 WP_128884994 type 4b pilus protein PilO2 -
VOT19_RS24480 (VOT19_24480) 78759..80390 - 1632 WP_128884995 PilN family type IVB pilus formation outer membrane protein -
VOT19_RS24485 (VOT19_24485) 80412..80834 - 423 WP_128884996 type IV pilus biogenesis protein PilM -
VOT19_RS24490 (VOT19_24490) 80834..81814 - 981 WP_128884997 toxin co-regulated pilus biosynthesis Q family protein -

Host bacterium

ID   20723 GenBank   NZ_CP142090
Plasmid name   pKM0228a Incompatibility group   -
Plasmid size   83778 bp Coordinate of oriT [Strand]   43682..43765 [+]
Host baterium   Serratia sarumanii strain K-M0228

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -