Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   120264
Name   oriT_LMB1|pC in_silico
Organism   Sinorhizobium meliloti strain LMB1
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP141215 (53511..53565 [+], 55 nt)
oriT length   55 nt
IRs (inverted repeats)      2..7, 21..26  (GGAAAA..TTTTCC)
Location of nic site      34..35
Conserved sequence flanking the
  nic site  
 
 TCCTGCCTCT
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 55 nt

>oriT_LMB1|pC
AGGAAAAGGGCGTAGCACATTTTTCCGTATCCTGCCTCTCCAAATTGTAAGGGGA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   14961 GenBank   WP_324765555
Name   t4cp2_SO078_RS29785_LMB1|pC insolico UniProt ID   _
Length   699 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 699 a.a.        Molecular weight: 77671.63 Da        Isoelectric Point: 9.8652

>WP_324765555.1 type IV secretory system conjugative DNA transfer family protein [Sinorhizobium meliloti]
MTKQLQAFYLLFCVGIAFVVWMLGYGLGLQLFYKDGRILETTITSNPFAPIQQFWHYKTSPALQKVALAS
MVPALLVAGLVAYIGLKPTSSPLGDAAFQDMASLRRGKWFRKQGHIFGRIGRNILRTKDDRHHLIIGPTR
SGKGAGYVIPNALMHEGSMIVTDLKGEVFKATAGYRRQNGSQVFLFAPGSEKTNSYNPLDFIRPERGNRT
TDIQNIASILVPENTGSENSVWQATAQQVLAGVISYITESPFFKDRRNLSEVNSFFNSGADLQALMKYIK
EKEPYLSKFTVESFNSYIALSERAAASALLDIQKAMRPFKNERIVAATNVTDMDLRAMKRRPISIYLAPN
ITDITLLRPLLTLFVQQVMDILTLEHDPNSLPVYFLLDEFRQLKRMDEIMTKLPYVAGYNIKLAFIIQDL
KNLDEIYGETSRHSLLGNCGYQLVLGANDQATAEYASRALGKRTIRYQSESRTIELMGLPRRTKVEQIRE
RDLMMPQEVRQMPENKMILLIEGQRPIFGEKLRFFRTQPFKSAEAFSQANIPQVPEVDYLSPKPVPATTP
EYAKGGDPSVEIPSPAPAKNEKPFTAAAAEAAPVKAEPAADEKAAAPAKRTVNTKALRPKPKATAANTGG
AEASASLDAMEARIKAIEEGLKPKAAQLKEVVDTKAEKLGDKSPTKRRNIMDIFSTTIPDPVDVGMPAE

  Protein domains


Predicted by InterproScan.

(103-533)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 20577..30499

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SO078_RS29690 (SO078_29690) 15741..16075 + 335 Protein_19 hypothetical protein -
SO078_RS29695 (SO078_29695) 16158..16574 - 417 WP_324765542 hypothetical protein -
SO078_RS29700 (SO078_29700) 16594..17190 - 597 WP_324765543 hypothetical protein -
SO078_RS29705 (SO078_29705) 17192..17536 - 345 WP_324765544 hypothetical protein -
SO078_RS29710 (SO078_29710) 17592..18293 - 702 WP_324765545 thermonuclease family protein -
SO078_RS29715 (SO078_29715) 18290..18826 - 537 WP_324765546 thermonuclease family protein -
SO078_RS29720 (SO078_29720) 18823..19431 - 609 WP_324765547 hypothetical protein -
SO078_RS29725 (SO078_29725) 19654..20565 + 912 WP_324765615 lytic transglycosylase domain-containing protein -
SO078_RS29730 (SO078_29730) 20577..20915 + 339 WP_015241462 TrbC/VirB2 family protein virB2
SO078_RS29735 (SO078_29735) 20919..21218 + 300 WP_020479309 type IV secretion system protein VirB3 virB3
SO078_RS29740 (SO078_29740) 21221..23680 + 2460 WP_324765548 VirB4 family type IV secretion/conjugal transfer ATPase virb4
SO078_RS29745 (SO078_29745) 23677..24765 + 1089 WP_324765549 lytic transglycosylase domain-containing protein -
SO078_RS29750 (SO078_29750) 24777..25478 + 702 WP_324765550 type IV secretion system protein -
SO078_RS29755 (SO078_29755) 25468..25695 + 228 WP_127676176 hypothetical protein -
SO078_RS29760 (SO078_29760) 25711..26739 + 1029 WP_318931155 type IV secretion system protein virB6
SO078_RS29765 (SO078_29765) 26778..27473 + 696 WP_324765551 type IV secretion system protein virB8
SO078_RS29770 (SO078_29770) 27470..28279 + 810 WP_324765552 TrbG/VirB9 family P-type conjugative transfer protein virB9
SO078_RS29775 (SO078_29775) 28279..29490 + 1212 WP_324765553 type IV secretion system protein VirB10 virB10
SO078_RS29780 (SO078_29780) 29471..30499 + 1029 WP_324765554 P-type DNA transfer ATPase VirB11 virB11
SO078_RS29785 (SO078_29785) 30496..32595 + 2100 WP_324765555 type IV secretory system conjugative DNA transfer family protein -
SO078_RS29790 (SO078_29790) 33970..34182 - 213 WP_107591998 hypothetical protein -
SO078_RS29795 (SO078_29795) 34206..34727 - 522 WP_324765556 hypothetical protein -


Host bacterium


ID   20693 GenBank   NZ_CP141215
Plasmid name   LMB1|pC Incompatibility group   -
Plasmid size   337726 bp Coordinate of oriT [Strand]   53511..53565 [+]
Host baterium   Sinorhizobium meliloti strain LMB1

Cargo genes


Drug resistance gene   -
Virulence gene   htpB
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -