Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   120093
Name   oriT_SJTUF14170|p14170A in_silico
Organism   Salmonella sp. SJTUF14170
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP064664 (6768..6928 [+], 161 nt)
oriT length   161 nt
IRs (inverted repeats)      39..44, 48..53  (CCGTAC..GTACGG)
 6..13, 15..22  (GTTTCTCT..AGAGAAAC)
Location of nic site      33..34
Conserved sequence flanking the
  nic site    		  GTGCGCCCTC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 161 nt

>oriT_SJTUF14170|p14170A
GGCCAGTTTCTCTAAGAGAAACCGGTAAGTGCGCCCTCCCGTACAAAGTACGGTCGGGGTTTGCCGCCGTCGTGCCTCCATGATAGCCTAAGAGACAGCACATTAACAATGAGGTGTCAAGATGGCTAAGGGGAGCAACAAGGCGGCGGATAGGCTGGCCA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   12653 GenBank   WP_223820406
Name   Mob_Pre_IVP17_RS23390_SJTUF14170|p14170A insolico UniProt ID   _
Length   103 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 103 a.a.        Molecular weight: 11864.27 Da        Isoelectric Point: 7.7517

>WP_223820406.1 MULTISPECIES: plasmid recombination protein [Gammaproteobacteria]
MGTVAAALQHCYRDRETPNADQERTPDNDHLAARSTDEAMGKLRERLPEKRRKDAVLAVEYVMSASPEWW
QTASADQQREFFKRSTEWLAACRKFRCSATAMN

  Protein domains


Predicted by InterproScan.

Plasmid recombination enzyme (Mob_Pre)

(4-90)


  Protein structure



No available structure.




Host bacterium

ID   20523 GenBank   NZ_CP064664
Plasmid name   SJTUF14170|p14170A Incompatibility group   -
Plasmid size   7856 bp Coordinate of oriT [Strand]   6768..6928 [+]
Host baterium   Salmonella sp. SJTUF14170

Cargo genes

Drug resistance gene   floR
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -