Detailed information of oriT

oriT

The information of the oriT region

• oriTDB ID: 120075
• Name: oriT_B4311|unnamed2
• Organism: Ligilactobacillus salivarius strain B4311
• Sequence Completeness: -
• NCBI accession of oriT (coordinates [strand]): NZ_CP117985 (3353..3403 [+], 51 nt)
• oriT length: 51 nt
• IRs (inverted repeats): 13..18, 25..30 (TCCCAC..GTGGGA)
• Location of nic site: _
• Conserved sequence flanking the nic site: _
• Note: Predicted by oriTfinder 2.0

oriT sequence

• Length: 51 nt

>oriT_B4311|unnamed2
GATACTATCGGCTCCCACGCACCTGTGGGACCATTTTCTCTTATGCTCTTT

oriT secondary structure

Predicted by RNAfold.

Relaxase

Rep_trans_PTA89_RS10255_B4311|unnamed2

• ID: 12643
• GenBank: WP_301207687
• Name: Rep_trans_PTA89_RS10255_B4311|unnamed2
• UniProt ID: _
• Length: 251 a.a.
• Note: Predicted by oriTfinder 2.0

Relaxase protein sequence

• Length: 251 a.a.
• Molecular weight: 28729.11 Da
• Isoelectric Point: 9.1073

>WP_301207687.1 replication initiation factor domain-containing protein [Ligilactobacillus salivarius]
MPVTSTIKQTLQTSIDWLEFTIFQLSYEDVIERILQLKIEDFADLSKGKFGYNAQTKWGNGNLFVLFNQV
DDEPCINHMGVHVILSGTGCRAYESQKSLYTLINVLVALENQAKLSRIDLAIDDFKDELIKFSRIRKAAL
RSEFTSRWNKWDELNSRSTGDGKLLGQTMYFGSQTSDIFCRIYDKALEQKCKVKYNTLYFIFIKCVLCEA
VGSADQNHKTFKTFLFFTRKKKQKNLPSATSAKGGFALVLV

Protein domains

Predicted by InterproScan.

• Rolling Circle replication initiation protein N-terminal domain (Rol_Rep_N) (13-95)

• Replication initiation factor (Rep_trans) (114-194)

Protein structure

No available structure.

Host bacterium

• ID: 20505
• GenBank: NZ_CP117985
• Plasmid name: B4311|unnamed2
• Incompatibility group: -
• Plasmid size: 21670 bp
• Coordinate of oriT [Strand]: 3353..3403 [+]
• Host baterium: Ligilactobacillus salivarius strain B4311

Cargo genes

• Drug resistance gene: tet(M), tet(L)
• Virulence gene: -
• Metal resistance gene: -
• Degradation gene: -
• Symbiosis gene: -
• Anti-CRISPR: -