Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   120014
Name   oriT_pKqs_12A476_2 in_silico
Organism   Klebsiella quasipneumoniae subsp. similipneumoniae strain 12A476
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP084781 (87238..87287 [-], 50 nt)
oriT length   50 nt
IRs (inverted repeats)      7..14, 17..24  (GCAAAATT..AATTTTGC)
Location of nic site      33..34
Conserved sequence flanking the
  nic site  
 
 TGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 50 nt

>oriT_pKqs_12A476_2
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   14814 GenBank   WP_040215031
Name   traD_LGM27_RS26675_pKqs_12A476_2 insolico UniProt ID   _
Length   760 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 760 a.a.        Molecular weight: 85020.03 Da        Isoelectric Point: 4.9634

>WP_040215031.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLTMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSREIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDERVDARLSALLEAREAEGSLARALFTPDAPEPGPADTDSHAGEQPEPVSPPA
PAEMTVSPAPVKAPPTTKRPAAEPPVLPVTPIPLLKPKAAAAAATASSAGTPAAAAGGTEQELAQQSAEQ
GQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNI

  Protein domains


Predicted by InterproScan.

(172-560)

(32-128)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 86680..119428

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LGM27_RS26450 (LGM27_26450) 81782..82132 + 351 WP_004153414 hypothetical protein -
LGM27_RS26455 (LGM27_26455) 82762..83115 + 354 WP_004152748 hypothetical protein -
LGM27_RS26460 (LGM27_26460) 83172..83519 + 348 WP_004152749 hypothetical protein -
LGM27_RS26465 (LGM27_26465) 83614..83760 + 147 WP_004152750 hypothetical protein -
LGM27_RS26470 (LGM27_26470) 83811..84644 + 834 WP_004152751 N-6 DNA methylase -
LGM27_RS26475 (LGM27_26475) 85464..86285 + 822 WP_004152492 DUF932 domain-containing protein -
LGM27_RS26480 (LGM27_26480) 86318..86647 + 330 WP_011977736 DUF5983 family protein -
LGM27_RS26485 (LGM27_26485) 86680..87165 - 486 WP_022631514 transglycosylase SLT domain-containing protein virB1
LGM27_RS26490 (LGM27_26490) 87556..87972 + 417 WP_168429831 conjugal transfer relaxosome DNA-binding protein TraM -
LGM27_RS26495 (LGM27_26495) 88172..88891 + 720 WP_162920041 conjugal transfer protein TrbJ -
LGM27_RS26500 (LGM27_26500) 89024..89227 + 204 WP_171486139 TraY domain-containing protein -
LGM27_RS26505 (LGM27_26505) 89292..89660 + 369 WP_004194426 type IV conjugative transfer system pilin TraA -
LGM27_RS26510 (LGM27_26510) 89674..89979 + 306 WP_004144424 type IV conjugative transfer system protein TraL traL
LGM27_RS26515 (LGM27_26515) 89999..90565 + 567 WP_004144423 type IV conjugative transfer system protein TraE traE
LGM27_RS26520 (LGM27_26520) 90552..91292 + 741 WP_004152497 type-F conjugative transfer system secretin TraK traK
LGM27_RS26525 (LGM27_26525) 91292..92716 + 1425 WP_032426793 F-type conjugal transfer pilus assembly protein TraB traB
LGM27_RS26530 (LGM27_26530) 92830..93414 + 585 WP_004161368 type IV conjugative transfer system lipoprotein TraV traV
LGM27_RS26535 (LGM27_26535) 93546..93956 + 411 WP_004152499 hypothetical protein -
LGM27_RS26540 (LGM27_26540) 94062..94280 + 219 WP_122008102 hypothetical protein -
LGM27_RS26545 (LGM27_26545) 94281..94592 + 312 WP_004152502 hypothetical protein -
LGM27_RS26550 (LGM27_26550) 94659..95063 + 405 WP_004152503 hypothetical protein -
LGM27_RS26555 (LGM27_26555) 95106..95495 + 390 WP_004153076 hypothetical protein -
LGM27_RS26560 (LGM27_26560) 95503..95901 + 399 WP_011977783 hypothetical protein -
LGM27_RS26565 (LGM27_26565) 95973..98612 + 2640 WP_004152505 type IV secretion system protein TraC virb4
LGM27_RS26570 (LGM27_26570) 98612..99001 + 390 WP_004152506 type-F conjugative transfer system protein TrbI -
LGM27_RS26575 (LGM27_26575) 99001..99627 + 627 WP_032420974 type-F conjugative transfer system protein TraW traW
LGM27_RS26580 (LGM27_26580) 99669..100058 + 390 WP_032445235 hypothetical protein -
LGM27_RS26585 (LGM27_26585) 100055..101044 + 990 WP_011977785 conjugal transfer pilus assembly protein TraU traU
LGM27_RS26590 (LGM27_26590) 101057..101695 + 639 WP_004193871 type-F conjugative transfer system pilin assembly protein TrbC trbC
LGM27_RS26595 (LGM27_26595) 101754..103709 + 1956 WP_048292285 type-F conjugative transfer system mating-pair stabilization protein TraN traN
LGM27_RS26600 (LGM27_26600) 103741..103995 + 255 WP_004152674 conjugal transfer protein TrbE -
LGM27_RS26605 (LGM27_26605) 103973..104221 + 249 WP_004152675 hypothetical protein -
LGM27_RS26610 (LGM27_26610) 104234..104560 + 327 WP_004144402 hypothetical protein -
LGM27_RS26615 (LGM27_26615) 104581..105333 + 753 WP_020803149 type-F conjugative transfer system pilin assembly protein TraF traF
LGM27_RS26620 (LGM27_26620) 105344..105583 + 240 WP_004152687 type-F conjugative transfer system pilin chaperone TraQ -
LGM27_RS26625 (LGM27_26625) 105555..106127 + 573 WP_023292147 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
LGM27_RS26630 (LGM27_26630) 106120..106548 + 429 WP_015065560 hypothetical protein -
LGM27_RS26635 (LGM27_26635) 106535..107905 + 1371 WP_004159274 conjugal transfer pilus assembly protein TraH traH
LGM27_RS26640 (LGM27_26640) 107905..110748 + 2844 WP_032420975 conjugal transfer mating-pair stabilization protein TraG traG
LGM27_RS26645 (LGM27_26645) 110759..111283 + 525 WP_015065538 hypothetical protein -
LGM27_RS26650 (LGM27_26650) 111642..112667 + 1026 WP_064782720 IS110 family transposase -
LGM27_RS26655 (LGM27_26655) 112986..113954 - 969 WP_072193976 IS5-like element IS903B family transposase -
LGM27_RS26660 (LGM27_26660) 114249..115274 - 1026 WP_064782720 IS110 family transposase -
LGM27_RS26665 (LGM27_26665) 115406..116137 + 732 WP_013023830 conjugal transfer complement resistance protein TraT -
LGM27_RS26670 (LGM27_26670) 116330..117019 + 690 WP_165457226 hypothetical protein -
LGM27_RS26675 (LGM27_26675) 117146..119428 + 2283 WP_040215031 type IV conjugative transfer system coupling protein TraD virb4


Host bacterium


ID   20444 GenBank   NZ_CP084781
Plasmid name   pKqs_12A476_2 Incompatibility group   IncFIA
Plasmid size   130593 bp Coordinate of oriT [Strand]   87238..87287 [-]
Host baterium   Klebsiella quasipneumoniae subsp. similipneumoniae strain 12A476

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIE9